BLASTX nr result
ID: Ophiopogon26_contig00027244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027244 (570 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POE57334.1| spindle and kinetochore-associated protein 1 like... 65 3e-09 gb|POE52693.1| spindle and kinetochore-associated protein 1 like... 65 3e-09 ref|XP_009397883.1| PREDICTED: spindle and kinetochore-associate... 65 4e-09 gb|POE57333.1| spindle and kinetochore-associated protein 1 like... 65 5e-09 ref|XP_020247714.1| spindle and kinetochore-associated protein 1... 62 3e-08 ref|XP_020247713.1| spindle and kinetochore-associated protein 1... 62 3e-08 ref|XP_020247712.1| spindle and kinetochore-associated protein 1... 62 3e-08 ref|XP_020247711.1| spindle and kinetochore-associated protein 1... 62 4e-08 gb|EMS58746.1| hypothetical protein TRIUR3_30197 [Triticum urartu] 62 4e-08 ref|XP_023898885.1| spindle and kinetochore-associated protein 1... 62 4e-08 ref|XP_023895508.1| spindle and kinetochore-associated protein 1... 62 4e-08 ref|XP_006658560.1| PREDICTED: spindle and kinetochore-associate... 62 5e-08 gb|OMO78551.1| hypothetical protein CCACVL1_14316 [Corchorus cap... 62 6e-08 ref|XP_007052131.2| PREDICTED: spindle and kinetochore-associate... 62 6e-08 gb|EOX96288.1| Spindle and kinetochore-associated protein 1 isof... 62 6e-08 gb|PHT48355.1| Spindle and kinetochore-associated protein 1 -lik... 61 7e-08 ref|XP_010258977.1| PREDICTED: spindle and kinetochore-associate... 61 8e-08 ref|XP_012843572.1| PREDICTED: spindle and kinetochore-associate... 61 1e-07 ref|XP_022769669.1| spindle and kinetochore-associated protein 1... 61 1e-07 ref|XP_020175752.1| spindle and kinetochore-associated protein 1... 61 1e-07 >gb|POE57334.1| spindle and kinetochore-associated protein 1 like [Quercus suber] Length = 266 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 146 IQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 +QELRDIA TDAV+GKHF+LESDIK P LKLDN GK T+ Sbjct: 202 VQELRDIAMTDAVKGKHFFLESDIKGPALKLDNTGKAILTV 242 >gb|POE52693.1| spindle and kinetochore-associated protein 1 like [Quercus suber] Length = 266 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 146 IQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 +QELRDIA TDAV+GKHF+LESDIK P LKLDN GK T+ Sbjct: 202 VQELRDIAMTDAVKGKHFFLESDIKGPALKLDNTGKAILTV 242 >ref|XP_009397883.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Musa acuminata subsp. malaccensis] ref|XP_018679914.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Musa acuminata subsp. malaccensis] ref|XP_018679915.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Musa acuminata subsp. malaccensis] Length = 269 Score = 64.7 bits (156), Expect = 4e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 149 KIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 K ELRDIATT+AV+GKHF+LE+DIK PGLKLDN GK T+ Sbjct: 204 KALELRDIATTEAVKGKHFFLETDIKGPGLKLDNTGKAILTV 245 >gb|POE57333.1| spindle and kinetochore-associated protein 1 like [Quercus suber] Length = 376 Score = 65.1 bits (157), Expect = 5e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 146 IQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 +QELRDIA TDAV+GKHF+LESDIK P LKLDN GK T+ Sbjct: 312 VQELRDIAMTDAVKGKHFFLESDIKGPALKLDNTGKAILTV 352 >ref|XP_020247714.1| spindle and kinetochore-associated protein 1 homolog isoform X4 [Asparagus officinalis] gb|ONK55706.1| uncharacterized protein A4U43_C10F170 [Asparagus officinalis] Length = 268 Score = 62.4 bits (150), Expect = 3e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -2 Query: 149 KIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 K ELRDIAT + VRGKHF+LE+DIK PGLKLDN GK T+ Sbjct: 203 KALELRDIATAETVRGKHFFLETDIKGPGLKLDNTGKAILTV 244 >ref|XP_020247713.1| spindle and kinetochore-associated protein 1 homolog isoform X3 [Asparagus officinalis] Length = 277 Score = 62.4 bits (150), Expect = 3e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -2 Query: 149 KIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 K ELRDIAT + VRGKHF+LE+DIK PGLKLDN GK T+ Sbjct: 212 KALELRDIATAETVRGKHFFLETDIKGPGLKLDNTGKAILTV 253 >ref|XP_020247712.1| spindle and kinetochore-associated protein 1 homolog isoform X2 [Asparagus officinalis] Length = 283 Score = 62.4 bits (150), Expect = 3e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -2 Query: 149 KIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 K ELRDIAT + VRGKHF+LE+DIK PGLKLDN GK T+ Sbjct: 218 KALELRDIATAETVRGKHFFLETDIKGPGLKLDNTGKAILTV 259 >ref|XP_020247711.1| spindle and kinetochore-associated protein 1 homolog isoform X1 [Asparagus officinalis] Length = 307 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -2 Query: 149 KIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 K ELRDIAT + VRGKHF+LE+DIK PGLKLDN GK T+ Sbjct: 242 KALELRDIATAETVRGKHFFLETDIKGPGLKLDNTGKAILTV 283 >gb|EMS58746.1| hypothetical protein TRIUR3_30197 [Triticum urartu] Length = 317 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 149 KIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTLS 21 K ELRDIA T+AV+GKHF+LE+DIK PGLKLD+ GK TL+ Sbjct: 231 KALELRDIAATEAVKGKHFFLEADIKGPGLKLDHTGKAILTLN 273 >ref|XP_023898885.1| spindle and kinetochore-associated protein 1 homolog [Quercus suber] Length = 270 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -2 Query: 140 ELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 ELRDIA TDAV+GKHF+LESDIK P LKLDN GK T+ Sbjct: 208 ELRDIAMTDAVKGKHFFLESDIKGPALKLDNTGKAILTV 246 >ref|XP_023895508.1| spindle and kinetochore-associated protein 1 homolog [Quercus suber] Length = 270 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -2 Query: 140 ELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 ELRDIA TDAV+GKHF+LESDIK P LKLDN GK T+ Sbjct: 208 ELRDIAMTDAVKGKHFFLESDIKGPALKLDNTGKAILTV 246 >ref|XP_006658560.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Oryza brachyantha] Length = 259 Score = 61.6 bits (148), Expect = 5e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -2 Query: 149 KIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 K ELRDIA T++V+GKHF+LE+DIK PGLKLDN GK T+ Sbjct: 194 KALELRDIAATESVKGKHFFLETDIKGPGLKLDNTGKAILTV 235 >gb|OMO78551.1| hypothetical protein CCACVL1_14316 [Corchorus capsularis] Length = 273 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 140 ELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 ELRDIATT+AV+GKHF+LESD+K P LKLDN GK T+ Sbjct: 211 ELRDIATTEAVKGKHFFLESDMKGPSLKLDNTGKAILTV 249 >ref|XP_007052131.2| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Theobroma cacao] Length = 273 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 140 ELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 ELRDIATT+AV+GKHF+LESD+K P LKLDN GK T+ Sbjct: 211 ELRDIATTEAVKGKHFFLESDMKGPSLKLDNTGKAILTV 249 >gb|EOX96288.1| Spindle and kinetochore-associated protein 1 isoform 1 [Theobroma cacao] Length = 273 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 140 ELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 ELRDIATT+AV+GKHF+LESD+K P LKLDN GK T+ Sbjct: 211 ELRDIATTEAVKGKHFFLESDMKGPSLKLDNTGKAILTV 249 >gb|PHT48355.1| Spindle and kinetochore-associated protein 1 -like protein [Capsicum baccatum] Length = 266 Score = 61.2 bits (147), Expect = 7e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -2 Query: 158 LLYKIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 L+ + ELRDIA T+AV+GKHF+LE+DIK P LKLDN GK T+ Sbjct: 198 LVERAMELRDIAATEAVKGKHFFLETDIKGPSLKLDNTGKAILTV 242 >ref|XP_010258977.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Nelumbo nucifera] Length = 269 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -2 Query: 149 KIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 K ELRDIA T+AV+GKHF+LESDIK P LKLDN GK T+ Sbjct: 204 KALELRDIAMTEAVKGKHFFLESDIKGPALKLDNTGKAILTV 245 >ref|XP_012843572.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Erythranthe guttata] gb|EYU31960.1| hypothetical protein MIMGU_mgv1a011966mg [Erythranthe guttata] Length = 265 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -2 Query: 149 KIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 K ELR+I+TTD V+GKHF+LESDIK P LKLDN GK T+ Sbjct: 201 KALELREISTTDGVKGKHFFLESDIKGPSLKLDNTGKALLTV 242 >ref|XP_022769669.1| spindle and kinetochore-associated protein 1 homolog [Durio zibethinus] Length = 272 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -2 Query: 149 KIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 K ELRDIATT+A++GKHF+LE+D+K P LKLDN GK T+ Sbjct: 207 KALELRDIATTEAIKGKHFFLETDMKGPSLKLDNTGKAILTV 248 >ref|XP_020175752.1| spindle and kinetochore-associated protein 1 homolog isoform X2 [Aegilops tauschii subsp. tauschii] Length = 274 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -2 Query: 149 KIQELRDIATTDAVRGKHFYLESDIKEPGLKLDNIGKTTFTL 24 K ELRDIA T+AV+GKHF+LE+DIK PGLKLD+ GK T+ Sbjct: 209 KALELRDIAATEAVKGKHFFLEADIKGPGLKLDHTGKAILTV 250