BLASTX nr result
ID: Ophiopogon26_contig00027035
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027035 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAV92602.1| LRAT domain-containing protein [Cephalotus folli... 55 1e-06 dbj|GAV89192.1| LRAT domain-containing protein [Cephalotus folli... 54 5e-06 dbj|GAV74185.1| LRAT domain-containing protein [Cephalotus folli... 53 9e-06 >dbj|GAV92602.1| LRAT domain-containing protein [Cephalotus follicularis] Length = 200 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/45 (57%), Positives = 33/45 (73%), Gaps = 4/45 (8%) Frame = +3 Query: 6 NNCEHFATFCRTGRRFSGQIFIKY----PHLKQLPTLERENMAAG 128 NNCEHFATFC+TGR+FSGQ+ K +L++LP E E +AAG Sbjct: 155 NNCEHFATFCKTGRKFSGQVMAKRVAPGVNLEELPIEELEKIAAG 199 >dbj|GAV89192.1| LRAT domain-containing protein [Cephalotus follicularis] Length = 201 Score = 53.5 bits (127), Expect = 5e-06 Identities = 24/46 (52%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = +3 Query: 6 NNCEHFATFCRTGRRFSGQIFIKY-PHLKQLPTLERENMAAGNCTN 140 NNCEHFAT+CRTG +FSGQ+ K+ ++QLP E E + +G N Sbjct: 153 NNCEHFATYCRTGTKFSGQVIPKFGDTVQQLPICEIEKITSGTYVN 198 >dbj|GAV74185.1| LRAT domain-containing protein [Cephalotus follicularis] Length = 200 Score = 52.8 bits (125), Expect = 9e-06 Identities = 25/45 (55%), Positives = 32/45 (71%), Gaps = 4/45 (8%) Frame = +3 Query: 6 NNCEHFATFCRTGRRFSGQIFIKY----PHLKQLPTLERENMAAG 128 NNCEHFAT C+TGR+FSGQ+ K +L++LP E E +AAG Sbjct: 155 NNCEHFATLCKTGRKFSGQVMAKRVAPGVNLEELPIEELEKIAAG 199