BLASTX nr result
ID: Ophiopogon26_contig00027034
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027034 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAV89192.1| LRAT domain-containing protein [Cephalotus folli... 56 7e-07 dbj|GAV92602.1| LRAT domain-containing protein [Cephalotus folli... 55 1e-06 dbj|GAV90701.1| LRAT domain-containing protein [Cephalotus folli... 54 3e-06 dbj|GAV90699.1| LRAT domain-containing protein [Cephalotus folli... 54 7e-06 dbj|GAV74185.1| LRAT domain-containing protein [Cephalotus folli... 53 9e-06 >dbj|GAV89192.1| LRAT domain-containing protein [Cephalotus follicularis] Length = 201 Score = 56.2 bits (134), Expect = 7e-07 Identities = 26/46 (56%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +3 Query: 6 NNCEHFATFCRTGSKFSGQVFIRY-PLLEQKPTHEIENIAAGNCTN 140 NNCEHFAT+CRTG+KFSGQV ++ ++Q P EIE I +G N Sbjct: 153 NNCEHFATYCRTGTKFSGQVIPKFGDTVQQLPICEIEKITSGTYVN 198 >dbj|GAV92602.1| LRAT domain-containing protein [Cephalotus follicularis] Length = 200 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 4/45 (8%) Frame = +3 Query: 6 NNCEHFATFCRTGSKFSGQVFIRYPL----LEQKPTHEIENIAAG 128 NNCEHFATFC+TG KFSGQV + LE+ P E+E IAAG Sbjct: 155 NNCEHFATFCKTGRKFSGQVMAKRVAPGVNLEELPIEELEKIAAG 199 >dbj|GAV90701.1| LRAT domain-containing protein [Cephalotus follicularis] Length = 200 Score = 54.3 bits (129), Expect = 3e-06 Identities = 29/46 (63%), Positives = 32/46 (69%), Gaps = 4/46 (8%) Frame = +3 Query: 6 NNCEHFATFCRTGSKFSGQVF-IRYPLL---EQKPTHEIENIAAGN 131 NNCEHFATFCRTG KFSGQV R P L E P E+E +AAG+ Sbjct: 153 NNCEHFATFCRTGRKFSGQVLPWRLPDLYKPEMVPIEELEKLAAGD 198 >dbj|GAV90699.1| LRAT domain-containing protein [Cephalotus follicularis] Length = 203 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 4/45 (8%) Frame = +3 Query: 6 NNCEHFATFCRTGSKFSGQVF-IRYPL---LEQKPTHEIENIAAG 128 NNCEHFATFCRTG KFSGQV R P E+ P ++E IAAG Sbjct: 156 NNCEHFATFCRTGRKFSGQVIPTRLPAGVKPEEVPIEDLEKIAAG 200 >dbj|GAV74185.1| LRAT domain-containing protein [Cephalotus follicularis] Length = 200 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 4/45 (8%) Frame = +3 Query: 6 NNCEHFATFCRTGSKFSGQVFIRYPL----LEQKPTHEIENIAAG 128 NNCEHFAT C+TG KFSGQV + LE+ P E+E IAAG Sbjct: 155 NNCEHFATLCKTGRKFSGQVMAKRVAPGVNLEELPIEELEKIAAG 199