BLASTX nr result
ID: Ophiopogon26_contig00026991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026991 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242493.1| peroxisome biogenesis protein 22-like [Aspar... 57 5e-07 >ref|XP_020242493.1| peroxisome biogenesis protein 22-like [Asparagus officinalis] Length = 252 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +3 Query: 222 LIVVDFQLEHAGSFGALAGFAIAVIFTWKFLKPAP 326 ++V+ F +H+G+FGALAGFAIAVIFTW+F+KPAP Sbjct: 27 IVVLLFNHKHSGTFGALAGFAIAVIFTWRFMKPAP 61