BLASTX nr result
ID: Ophiopogon26_contig00026919
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026919 (750 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK69802.1| uncharacterized protein A4U43_C05F26890 [Asparagu... 61 5e-07 ref|XP_020264956.1| lysM domain receptor-like kinase 3 [Asparagu... 61 6e-07 ref|XP_010915261.1| PREDICTED: lysM domain receptor-like kinase ... 57 9e-06 >gb|ONK69802.1| uncharacterized protein A4U43_C05F26890 [Asparagus officinalis] Length = 417 Score = 60.8 bits (146), Expect = 5e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 GLAKLVVTTIDGEASATKVVGTFGYLAPEYV 95 GLAKLVVTTIDGEAS TKVVGTFGYLAPEY+ Sbjct: 250 GLAKLVVTTIDGEASVTKVVGTFGYLAPEYL 280 >ref|XP_020264956.1| lysM domain receptor-like kinase 3 [Asparagus officinalis] Length = 599 Score = 60.8 bits (146), Expect = 6e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 GLAKLVVTTIDGEASATKVVGTFGYLAPEYV 95 GLAKLVVTTIDGEAS TKVVGTFGYLAPEY+ Sbjct: 432 GLAKLVVTTIDGEASVTKVVGTFGYLAPEYL 462 >ref|XP_010915261.1| PREDICTED: lysM domain receptor-like kinase 3 [Elaeis guineensis] Length = 660 Score = 57.4 bits (137), Expect = 9e-06 Identities = 32/53 (60%), Positives = 37/53 (69%), Gaps = 9/53 (16%) Frame = +3 Query: 3 GLAKLVVTTIDGEASATKVVGTFGYLAPEYVNPEI---------FGSLIFLIL 134 GLAKLVV T DGEASATKVVGTFGYLAPEY+ + FG ++F I+ Sbjct: 493 GLAKLVVKTGDGEASATKVVGTFGYLAPEYLRDGLATTKSDVYAFGVVLFEII 545