BLASTX nr result
ID: Ophiopogon26_contig00026877
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026877 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022845261.1| uncharacterized protein LOC111368250 [Olea e... 54 3e-06 gb|EFH51794.1| hypothetical protein ARALYDRAFT_905289 [Arabidops... 53 4e-06 >ref|XP_022845261.1| uncharacterized protein LOC111368250 [Olea europaea var. sylvestris] Length = 157 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +2 Query: 332 WMRGNSHVRFCSRDGIKKKPSTITLKELD 418 WMR NSHVRFCSRDGI K+PS+IT KELD Sbjct: 28 WMRRNSHVRFCSRDGIVKQPSSITPKELD 56 >gb|EFH51794.1| hypothetical protein ARALYDRAFT_905289 [Arabidopsis lyrata subsp. lyrata] Length = 112 Score = 52.8 bits (125), Expect = 4e-06 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +2 Query: 320 FARSWMRGNSHVRFCSRDGIKK-KPSTITLKELDFV 424 FARSWMR NSHV+F SRDGI +PSTIT KE DFV Sbjct: 71 FARSWMRRNSHVQFYSRDGISNLEPSTITQKEPDFV 106