BLASTX nr result
ID: Ophiopogon26_contig00026867
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026867 (892 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ22082.1| cytochrome c oxidase subunit 1, partial (mitocho... 127 3e-33 gb|AAT02446.1| cytochrome oxidase subunit I, partial (mitochondr... 129 1e-32 gb|AIG56980.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 1e-32 gb|AAT02447.1| cytochrome oxidase subunit I, partial (mitochondr... 129 1e-32 gb|ADR63945.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 1e-32 gb|AIG56971.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 1e-32 gb|AIG56987.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|AIG56963.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|AIG56978.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|AIG56965.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|AIG56961.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|ACD44518.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|ACD44499.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|ACD44490.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|ACD44487.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|ACD44447.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|ACD44440.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|ACD44414.1| cytochrome oxidase subunit 1, partial (mitochondr... 129 2e-32 gb|AAT02448.1| cytochrome oxidase subunit I, partial (mitochondr... 129 2e-32 gb|ACD44539.1| cytochrome oxidase subunit 1, partial (mitochondr... 127 4e-32 >dbj|BAJ22082.1| cytochrome c oxidase subunit 1, partial (mitochondrion) [Cycas taitungensis] Length = 107 Score = 127 bits (319), Expect = 3e-33 Identities = 62/66 (93%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELA+PGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 22 IFGAIAGVMGTCFSVLIRMELAQPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 81 Query: 358 GNRFVP 375 GN FVP Sbjct: 82 GNWFVP 87 >gb|AAT02446.1| cytochrome oxidase subunit I, partial (mitochondrion) [Dionaea muscipula] Length = 197 Score = 129 bits (323), Expect = 1e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 16 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 75 Query: 358 GNRFVP 375 GN FVP Sbjct: 76 GNWFVP 81 >gb|AIG56980.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix lucida] Length = 201 Score = 129 bits (323), Expect = 1e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|AAT02447.1| cytochrome oxidase subunit I, partial (mitochondrion) [Drosera capillaris] Length = 202 Score = 129 bits (323), Expect = 1e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 16 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 75 Query: 358 GNRFVP 375 GN FVP Sbjct: 76 GNWFVP 81 >gb|ADR63945.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Barringtonia racemosa] Length = 211 Score = 129 bits (323), Expect = 1e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 12 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 71 Query: 358 GNRFVP 375 GN FVP Sbjct: 72 GNWFVP 77 >gb|AIG56971.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix sitchensis] Length = 213 Score = 129 bits (323), Expect = 1e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|AIG56987.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix glauca] Length = 217 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 7 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 66 Query: 358 GNRFVP 375 GN FVP Sbjct: 67 GNWFVP 72 >gb|AIG56963.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix nivalis] Length = 217 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|AIG56978.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix pseudomonticola] Length = 218 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|AIG56965.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix lasiandra] Length = 218 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|AIG56961.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix bebbiana] Length = 218 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|ACD44518.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago canadensis var. scabra] Length = 218 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|ACD44499.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus odoratus] gb|ACD44500.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus odoratus] Length = 218 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|ACD44490.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus idaeus subsp. strigosus] gb|ACD44491.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus idaeus subsp. strigosus] gb|ACD44492.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus idaeus subsp. strigosus] gb|ACD44493.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus idaeus subsp. strigosus] gb|ACD44494.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus idaeus subsp. strigosus] gb|ACD44495.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus occidentalis] gb|ACD44496.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus occidentalis] gb|ACD44497.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus occidentalis] gb|ACD44498.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus occidentalis] Length = 218 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|ACD44487.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus allegheniensis] gb|ACD44488.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus allegheniensis] gb|ACD44489.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Rubus allegheniensis] Length = 218 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|ACD44447.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Poa annua] gb|ACD44448.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Poa annua] gb|ACD44449.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Poa compressa] gb|ACD44450.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Poa compressa] gb|ACD44451.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Poa compressa] gb|ACD44453.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Polygonum aviculare] gb|ACD44454.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Polygonum aviculare] gb|ACD44455.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Polygonum aviculare] gb|ACD44456.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Fallopia convolvulus] gb|ACD44457.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Fallopia convolvulus] gb|ACD44458.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Persicaria hydropiper] gb|ACD44459.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Persicaria hydropiper] gb|ACD44460.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Persicaria maculosa] gb|ACD44461.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Persicaria maculosa] gb|ACD44462.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Persicaria maculosa] gb|ACD44463.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Populus balsamifera] gb|ACD44464.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Populus balsamifera] gb|ACD44465.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Populus deltoides] gb|ACD44466.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Populus deltoides] gb|ACD44467.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Populus deltoides] gb|ACD44468.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Populus grandidentata] gb|ACD44469.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Populus grandidentata] gb|ACD44470.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Populus grandidentata] gb|ACD44471.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Populus tremuloides] gb|ACD44472.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Populus tremuloides] gb|ACD44473.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Populus tremuloides] gb|ACD44501.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix eriocephala] gb|ACD44502.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix eriocephala] gb|ACD44503.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix eriocephala] gb|ACD44504.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix eriocephala] gb|ACD44505.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix exigua] gb|ACD44506.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix exigua] gb|ACD44507.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix x pendulina] gb|ACD44508.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix x pendulina] gb|AIG56958.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix discolor] gb|AIG56959.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix bebbiana] gb|AIG56960.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix pseudomyrsinites] gb|AIG56962.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix bebbiana] gb|AIG56964.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix nivalis] gb|AIG56966.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix lasiandra] gb|AIG56967.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix lasiandra] gb|AIG56968.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix nakamurana] gb|AIG56969.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix sp. C DMP-2014] gb|AIG56970.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix sp. D DMP-2014] gb|AIG56972.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix interior x Salix eriocephala] gb|AIG56973.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix petiolaris] gb|AIG56974.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix interior x Salix petiolaris] gb|AIG56975.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix eriocephala] gb|AIG56976.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix candida] gb|AIG56977.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix pseudomonticola] gb|AIG56979.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix lucida] gb|AIG56981.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix serissima] gb|AIG56982.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix arctica] gb|AIG56983.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Salix alaxensis] Length = 218 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|ACD44440.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Plantago lanceolata] gb|ACD44441.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Plantago lanceolata] gb|ACD44442.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Plantago lanceolata] Length = 218 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|ACD44414.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Erigeron annuus] gb|ACD44415.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Erigeron annuus] gb|ACD44416.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Erigeron annuus] gb|ACD44417.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Erigeron strigosus] gb|ACD44418.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Erigeron strigosus] gb|ACD44419.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Erigeron strigosus] gb|ACD44420.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Erigeron strigosus] gb|ACD44452.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Polygonum aviculare] gb|ACD44515.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago canadensis var. scabra] gb|ACD44516.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago canadensis var. scabra] gb|ACD44517.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago canadensis var. scabra] gb|ACD44519.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago caesia] gb|ACD44520.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago caesia] gb|ACD44521.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago canadensis] gb|ACD44522.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago canadensis] gb|ACD44523.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago flexicaulis] gb|ACD44524.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago flexicaulis] gb|ACD44525.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago nemoralis] gb|ACD44526.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago nemoralis] gb|ACD44527.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago nemoralis] gb|ACD44528.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago rugosa] gb|ACD44529.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago rugosa] gb|ACD44530.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Solidago rugosa] gb|ACD44535.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Symphyotrichum ciliolatum] gb|ACD44536.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Symphyotrichum ericoides] gb|ACD44537.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Symphyotrichum lanceolatum] gb|ACD44538.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Symphyotrichum lanceolatum var. latifolium] gb|ACD44540.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Symphyotrichum novae-angliae] gb|ACD44541.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Symphyotrichum pilosum var. pilosum] gb|ACD44542.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Symphyotrichum pilosum var. pilosum] gb|ACD44543.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Symphyotrichum urophyllum] gb|ACD44544.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Symphyotrichum urophyllum] Length = 218 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 8 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 67 Query: 358 GNRFVP 375 GN FVP Sbjct: 68 GNWFVP 73 >gb|AAT02448.1| cytochrome oxidase subunit I, partial (mitochondrion) [Nepenthes sp. Jobson 1049] gb|AAT02451.1| cytochrome oxidase subunit I, partial (mitochondrion) [Heliamphora heterodoxa] Length = 220 Score = 129 bits (323), Expect = 2e-32 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 178 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGF 357 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGF Sbjct: 16 IFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGF 75 Query: 358 GNRFVP 375 GN FVP Sbjct: 76 GNWFVP 81 >gb|ACD44539.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Symphyotrichum lateriflorum] Length = 198 Score = 127 bits (319), Expect = 4e-32 Identities = 62/65 (95%), Positives = 63/65 (96%) Frame = +1 Query: 181 FGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLFYVLITAHAFLMIFFMVMPAMIGGFG 360 FGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL+ VLITAHAFLMIFFMVMPAMIGGFG Sbjct: 1 FGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGFG 60 Query: 361 NRFVP 375 N FVP Sbjct: 61 NWFVP 65