BLASTX nr result
ID: Ophiopogon26_contig00026784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026784 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266613.1| glycosyltransferase-like At2g41451 [Asparagu... 60 5e-08 ref|XP_010924548.1| PREDICTED: glycosyltransferase-like At2g4145... 57 4e-07 >ref|XP_020266613.1| glycosyltransferase-like At2g41451 [Asparagus officinalis] Length = 750 Score = 60.1 bits (144), Expect = 5e-08 Identities = 31/55 (56%), Positives = 40/55 (72%), Gaps = 4/55 (7%) Frame = -2 Query: 357 LPNSIAGESANTQKTAGSKE----SHATGRKILEFSGIFEKAIPPMSPPGLDNRH 205 LP+ +S++T +A +KE SHA RKILEFS IFEKA+PP+SPPGLD+ H Sbjct: 695 LPSMEEKKSSDTAGSANTKEDSTVSHAINRKILEFSDIFEKAVPPISPPGLDSVH 749 >ref|XP_010924548.1| PREDICTED: glycosyltransferase-like At2g41451 [Elaeis guineensis] Length = 529 Score = 57.4 bits (137), Expect = 4e-07 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = -2 Query: 357 LPNSIAGESANTQKTAGSKESHATGRKILEFSGIFEKAIPPMSPPGLDN 211 LPN S NT + AG KES+A+ RKILE + E AIPP+SPPGLD+ Sbjct: 480 LPNLSTAASKNTMRGAGGKESYASARKILETAVFTENAIPPISPPGLDD 528