BLASTX nr result
ID: Ophiopogon26_contig00026756
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026756 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260416.1| receptor-like kinase TMK3 [Asparagus officin... 64 4e-09 >ref|XP_020260416.1| receptor-like kinase TMK3 [Asparagus officinalis] ref|XP_020260417.1| receptor-like kinase TMK3 [Asparagus officinalis] gb|ONK71333.1| uncharacterized protein A4U43_C04F7400 [Asparagus officinalis] Length = 945 Score = 63.5 bits (153), Expect = 4e-09 Identities = 40/106 (37%), Positives = 46/106 (43%) Frame = -3 Query: 371 VKVLVNGNPQLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDAPKGSGKSKXXXXXXXX 192 VKV+VNGNP+LD DA KGS K K Sbjct: 446 VKVVVNGNPKLDPTAPPKSPPTDSPEGGSPGSSPNSRGSNSSDASKGSSKLKLVIIIVAI 505 Query: 191 XXXXXXXXXXXXXVYCRQRGKKGTFPDPTSIVIHPRDSSDPEDMVK 54 VY ++ KKGT+P PTSIVIHPRDSSDP + VK Sbjct: 506 VVGVLLISVVLLFVYFHRKAKKGTYPAPTSIVIHPRDSSDPGNAVK 551