BLASTX nr result
ID: Ophiopogon26_contig00026593
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026593 (563 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK69929.1| uncharacterized protein A4U43_C05F28330 [Asparagu... 64 3e-08 ref|XP_020265088.1| glutamate synthase 1 [NADH], chloroplastic i... 64 3e-08 >gb|ONK69929.1| uncharacterized protein A4U43_C05F28330 [Asparagus officinalis] Length = 2093 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 124 MAAVSGQTFKLRCDSVALPSALQRNRSTADQRRWRTARCA 5 MAAVSGQTFKLR DSVALPS+L RN+S A RRWRTARCA Sbjct: 1 MAAVSGQTFKLRSDSVALPSSLHRNQS-AGYRRWRTARCA 39 >ref|XP_020265088.1| glutamate synthase 1 [NADH], chloroplastic isoform X1 [Asparagus officinalis] Length = 2191 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 124 MAAVSGQTFKLRCDSVALPSALQRNRSTADQRRWRTARCA 5 MAAVSGQTFKLR DSVALPS+L RN+S A RRWRTARCA Sbjct: 1 MAAVSGQTFKLRSDSVALPSSLHRNQS-AGYRRWRTARCA 39