BLASTX nr result
ID: Ophiopogon26_contig00026365
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026365 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250030.1| uncharacterized protein LOC109827425 [Aspara... 55 4e-06 >ref|XP_020250030.1| uncharacterized protein LOC109827425 [Asparagus officinalis] ref|XP_020250031.1| uncharacterized protein LOC109827425 [Asparagus officinalis] gb|ONK55385.1| uncharacterized protein A4U43_UnF4020 [Asparagus officinalis] Length = 527 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = -3 Query: 412 RIQCRIGERDPQQPHRSHGTSVIAGRDRRWWSFF 311 RIQCRIGE+DP+QPHRS T+ +RRWW+FF Sbjct: 494 RIQCRIGEQDPRQPHRSRSTAADGHGNRRWWAFF 527