BLASTX nr result
ID: Ophiopogon26_contig00026203
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026203 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK61123.1| uncharacterized protein A4U43_C08F26480 [Asparagu... 59 9e-08 >gb|ONK61123.1| uncharacterized protein A4U43_C08F26480 [Asparagus officinalis] Length = 210 Score = 58.5 bits (140), Expect = 9e-08 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = +1 Query: 1 AHVGDFGLARFLKEIFXXXXXXXXXXAGLKGTVGYIAPGENY 126 AHVGDFGLARFLKEI GL+GT+GYIAPGEN+ Sbjct: 169 AHVGDFGLARFLKEIVSKSSQNSMSSVGLRGTIGYIAPGENF 210