BLASTX nr result
ID: Ophiopogon26_contig00026189
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026189 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK80490.1| uncharacterized protein A4U43_C01F18300 [Asparagu... 85 2e-18 ref|XP_020247671.1| LOW QUALITY PROTEIN: zinc finger CCCH domain... 85 7e-17 ref|XP_018682265.1| PREDICTED: zinc finger CCCH domain-containin... 59 1e-07 ref|XP_010240878.1| PREDICTED: zinc finger CCCH domain-containin... 57 6e-07 gb|OVA02923.1| zinc finger protein [Macleaya cordata] 56 2e-06 gb|PIA25381.1| hypothetical protein AQUCO_11700002v1 [Aquilegia ... 54 9e-06 >gb|ONK80490.1| uncharacterized protein A4U43_C01F18300 [Asparagus officinalis] Length = 144 Score = 85.1 bits (209), Expect = 2e-18 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +2 Query: 275 MDYGGRYSGSNAIEIIPDVSNTVGNEAWVPPSNDQSIWATEDDY 406 MDYGGRYSGSNAIEIIP+ S+T G+ AW+PPSNDQSIWATEDDY Sbjct: 1 MDYGGRYSGSNAIEIIPEASSTGGSNAWMPPSNDQSIWATEDDY 44 >ref|XP_020247671.1| LOW QUALITY PROTEIN: zinc finger CCCH domain-containing protein 56-like [Asparagus officinalis] Length = 353 Score = 85.1 bits (209), Expect = 7e-17 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +2 Query: 275 MDYGGRYSGSNAIEIIPDVSNTVGNEAWVPPSNDQSIWATEDDY 406 MDYGGRYSGSNAIEIIP+ S+T G+ AW+PPSNDQSIWATEDDY Sbjct: 1 MDYGGRYSGSNAIEIIPEASSTGGSNAWMPPSNDQSIWATEDDY 44 >ref|XP_018682265.1| PREDICTED: zinc finger CCCH domain-containing protein 56 [Musa acuminata subsp. malaccensis] Length = 357 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/46 (56%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = +2 Query: 275 MDYGG--RYSGSNAIEIIPDVSNTVGNEAWVPPSNDQSIWATEDDY 406 MDYGG Y GSNAI IIPD S G ++W+P +DQ +WAT++DY Sbjct: 1 MDYGGGTSYPGSNAIAIIPDASGPPGRDSWLPGGSDQLLWATDEDY 46 >ref|XP_010240878.1| PREDICTED: zinc finger CCCH domain-containing protein 56 [Nelumbo nucifera] Length = 367 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/46 (54%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = +2 Query: 275 MDYGGR--YSGSNAIEIIPDVSNTVGNEAWVPPSNDQSIWATEDDY 406 MDYGG +SG N +IIP++ + G + W+P NDQ+IWATEDDY Sbjct: 1 MDYGGEAGFSGGNVGQIIPEIPGSGGVDNWIPGLNDQAIWATEDDY 46 >gb|OVA02923.1| zinc finger protein [Macleaya cordata] Length = 376 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/46 (52%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = +2 Query: 275 MDYGGR--YSGSNAIEIIPDVSNTVGNEAWVPPSNDQSIWATEDDY 406 MDYGG +SG N +IIP++ ++ + W+P NDQ+IWATEDDY Sbjct: 1 MDYGGEAGFSGGNVGQIIPEIPSSGSMDNWIPGLNDQAIWATEDDY 46 >gb|PIA25381.1| hypothetical protein AQUCO_11700002v1 [Aquilegia coerulea] Length = 295 Score = 53.9 bits (128), Expect = 9e-06 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 5/49 (10%) Frame = +2 Query: 275 MDYGG----RYSGSNAIEIIPDVSNTVGN-EAWVPPSNDQSIWATEDDY 406 MDYGG R++ N +EIIP S +GN + W+P NDQ+IWATEDDY Sbjct: 1 MDYGGGGEGRFTSGNVVEIIPQ-SQDIGNLDNWMPGLNDQAIWATEDDY 48