BLASTX nr result
ID: Ophiopogon26_contig00026094
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026094 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK64156.1| uncharacterized protein A4U43_C07F22680 [Asparagu... 55 5e-07 >gb|ONK64156.1| uncharacterized protein A4U43_C07F22680 [Asparagus officinalis] Length = 110 Score = 55.5 bits (132), Expect = 5e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -3 Query: 458 TEVAPSKLVRVAKLRAAIILDTIAEEDAEESNEALASSFETIPRISRF 315 TEVAP + V+V KL+A+ ILD IAEE+ EE E L+SSFE+IP +F Sbjct: 62 TEVAPPQFVKVVKLKASKILDPIAEEETEEGIEDLSSSFESIPYFEQF 109