BLASTX nr result
ID: Ophiopogon26_contig00026082
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00026082 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268049.1| uncharacterized protein LOC109843525 [Aspara... 64 4e-09 >ref|XP_020268049.1| uncharacterized protein LOC109843525 [Asparagus officinalis] gb|ONK67684.1| uncharacterized protein A4U43_C05F2660 [Asparagus officinalis] Length = 485 Score = 63.5 bits (153), Expect = 4e-09 Identities = 32/97 (32%), Positives = 50/97 (51%) Frame = +1 Query: 88 HMIHGSFVNYSQPPMLLPQVEEANKFSTPMPNXXXXXXXXXXXXXXXXXXXXXXXXXGSN 267 H IH SFVN++QP ++ P+V+E NK+STP+P+ GS Sbjct: 140 HTIHRSFVNHAQPTIMPPRVDEINKYSTPVPSKSSSEKRKASRSAPKAPPPPKKYRIGSA 199 Query: 268 KNSHKMDGIKPSGNVPSASNSRVNKGSTSAVKLTSTS 378 K+ H ++ I +G PS +N++V G+ S + S S Sbjct: 200 KDPHMIEDIVSTGEAPSTNNTQVKMGNDSVINSISRS 236