BLASTX nr result
ID: Ophiopogon26_contig00025857
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00025857 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269528.1| beta carbonic anhydrase 5, chloroplastic-lik... 110 1e-26 ref|XP_020269527.1| beta carbonic anhydrase 5, chloroplastic-lik... 110 1e-26 ref|XP_009399692.1| PREDICTED: beta carbonic anhydrase 5, chloro... 107 2e-25 ref|XP_009417610.1| PREDICTED: beta carbonic anhydrase 5, chloro... 106 2e-25 gb|AQQ74305.1| beta-carbonic anhydrase 2b [Neurachne alopecuroidea] 105 1e-24 gb|ONM22365.1| carbonic anhydrase4 [Zea mays] 103 2e-24 gb|AQQ74304.1| beta-carbonic anhydrase 2a [Neurachne alopecuroidea] 105 2e-24 gb|KQL24852.1| hypothetical protein SETIT_030616mg [Setaria ital... 102 3e-24 ref|NP_001346645.1| carbonic anhydrase [Zea mays] >gi|194704668|... 103 5e-24 gb|KQL24850.1| hypothetical protein SETIT_030616mg [Setaria ital... 102 5e-24 gb|ONM22366.1| carbonic anhydrase4 [Zea mays] 103 6e-24 gb|ACL53080.1| unknown [Zea mays] >gi|1142857061|gb|ONM55545.1| ... 101 7e-24 ref|XP_008667450.1| carbonic anhydrase isoform X1 [Zea mays] >gi... 103 7e-24 gb|ONM55544.1| carbonic anhydrase5 [Zea mays] >gi|1142857064|gb|... 101 7e-24 ref|XP_021309500.1| beta carbonic anhydrase 5, chloroplastic-lik... 102 7e-24 gb|PAN12840.1| hypothetical protein PAHAL_B03130 [Panicum hallii] 102 8e-24 ref|XP_010939751.1| PREDICTED: beta carbonic anhydrase 5, chloro... 102 9e-24 ref|XP_004957059.1| beta carbonic anhydrase 5, chloroplastic iso... 102 1e-23 ref|XP_021309499.1| beta carbonic anhydrase 5, chloroplastic-lik... 102 1e-23 gb|OQU89630.1| hypothetical protein SORBI_3002G230100 [Sorghum b... 102 1e-23 >ref|XP_020269528.1| beta carbonic anhydrase 5, chloroplastic-like isoform X2 [Asparagus officinalis] Length = 307 Score = 110 bits (274), Expect = 1e-26 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRV+EGTL LHGGYYDFVNCTFEKWTLVY+E LEGGSKYAIKNRSFWS Sbjct: 256 PWIEKRVTEGTLSLHGGYYDFVNCTFEKWTLVYKEGLEGGSKYAIKNRSFWS 307 >ref|XP_020269527.1| beta carbonic anhydrase 5, chloroplastic-like isoform X1 [Asparagus officinalis] gb|ONK66423.1| uncharacterized protein A4U43_C06F7810 [Asparagus officinalis] Length = 308 Score = 110 bits (274), Expect = 1e-26 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRV+EGTL LHGGYYDFVNCTFEKWTLVY+E LEGGSKYAIKNRSFWS Sbjct: 257 PWIEKRVTEGTLSLHGGYYDFVNCTFEKWTLVYKEGLEGGSKYAIKNRSFWS 308 >ref|XP_009399692.1| PREDICTED: beta carbonic anhydrase 5, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 311 Score = 107 bits (266), Expect = 2e-25 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRVSE TL LHGGYYDF+NCTFEKWTLVYRE LEGGSKYAIKNRS WS Sbjct: 260 PWIEKRVSEATLSLHGGYYDFINCTFEKWTLVYRERLEGGSKYAIKNRSLWS 311 >ref|XP_009417610.1| PREDICTED: beta carbonic anhydrase 5, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 301 Score = 106 bits (265), Expect = 2e-25 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRVSEGTL LHGGYYDF++CTFEKWTLVYRE LEGGSKYAIKNR+ WS Sbjct: 250 PWIEKRVSEGTLSLHGGYYDFIDCTFEKWTLVYREGLEGGSKYAIKNRALWS 301 >gb|AQQ74305.1| beta-carbonic anhydrase 2b [Neurachne alopecuroidea] Length = 308 Score = 105 bits (261), Expect = 1e-24 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRVSEGTL LHGGYY+F++CTFEKWTLVYRE LEGGSKYAIKNRS WS Sbjct: 257 PWIEKRVSEGTLNLHGGYYNFIDCTFEKWTLVYREGLEGGSKYAIKNRSTWS 308 >gb|ONM22365.1| carbonic anhydrase4 [Zea mays] Length = 250 Score = 103 bits (256), Expect = 2e-24 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRV+EGTL LHGGYY+FV+CTFEKWTL+YRE LEGGSKYAIKNRS WS Sbjct: 199 PWIEKRVNEGTLNLHGGYYNFVDCTFEKWTLLYREGLEGGSKYAIKNRSTWS 250 >gb|AQQ74304.1| beta-carbonic anhydrase 2a [Neurachne alopecuroidea] Length = 352 Score = 105 bits (261), Expect = 2e-24 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRVSEGTL LHGGYY+F++CTFEKWTLVYRE LEGGSKYAIKNRS WS Sbjct: 301 PWIEKRVSEGTLNLHGGYYNFIDCTFEKWTLVYREGLEGGSKYAIKNRSTWS 352 >gb|KQL24852.1| hypothetical protein SETIT_030616mg [Setaria italica] Length = 247 Score = 102 bits (254), Expect = 3e-24 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWI+KRV+EGTL LHGGYY+F++CTFEKWTLVYRE LEGGSKYAIKNRS WS Sbjct: 196 PWIKKRVNEGTLNLHGGYYNFIDCTFEKWTLVYREGLEGGSKYAIKNRSTWS 247 >ref|NP_001346645.1| carbonic anhydrase [Zea mays] gb|ACF86418.1| unknown [Zea mays] gb|ACN31596.1| unknown [Zea mays] gb|ONM22363.1| carbonic anhydrase4 [Zea mays] gb|ONM22364.1| carbonic anhydrase4 [Zea mays] Length = 304 Score = 103 bits (256), Expect = 5e-24 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRV+EGTL LHGGYY+FV+CTFEKWTL+YRE LEGGSKYAIKNRS WS Sbjct: 253 PWIEKRVNEGTLNLHGGYYNFVDCTFEKWTLLYREGLEGGSKYAIKNRSTWS 304 >gb|KQL24850.1| hypothetical protein SETIT_030616mg [Setaria italica] Length = 269 Score = 102 bits (254), Expect = 5e-24 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWI+KRV+EGTL LHGGYY+F++CTFEKWTLVYRE LEGGSKYAIKNRS WS Sbjct: 218 PWIKKRVNEGTLNLHGGYYNFIDCTFEKWTLVYREGLEGGSKYAIKNRSTWS 269 >gb|ONM22366.1| carbonic anhydrase4 [Zea mays] Length = 313 Score = 103 bits (256), Expect = 6e-24 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRV+EGTL LHGGYY+FV+CTFEKWTL+YRE LEGGSKYAIKNRS WS Sbjct: 262 PWIEKRVNEGTLNLHGGYYNFVDCTFEKWTLLYREGLEGGSKYAIKNRSTWS 313 >gb|ACL53080.1| unknown [Zea mays] gb|ONM55545.1| carbonic anhydrase5 [Zea mays] Length = 247 Score = 101 bits (252), Expect = 7e-24 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFW 154 PWIEKRV+EGTL LHGGYY+FV+CTFEKWTL+YRE LEGGSKYAIKNRS W Sbjct: 196 PWIEKRVNEGTLNLHGGYYNFVDCTFEKWTLLYREGLEGGSKYAIKNRSTW 246 >ref|XP_008667450.1| carbonic anhydrase isoform X1 [Zea mays] gb|ONM22362.1| carbonic anhydrase4 [Zea mays] Length = 323 Score = 103 bits (256), Expect = 7e-24 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRV+EGTL LHGGYY+FV+CTFEKWTL+YRE LEGGSKYAIKNRS WS Sbjct: 272 PWIEKRVNEGTLNLHGGYYNFVDCTFEKWTLLYREGLEGGSKYAIKNRSTWS 323 >gb|ONM55544.1| carbonic anhydrase5 [Zea mays] gb|ONM55548.1| carbonic anhydrase5 [Zea mays] Length = 250 Score = 101 bits (252), Expect = 7e-24 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFW 154 PWIEKRV+EGTL LHGGYY+FV+CTFEKWTL+YRE LEGGSKYAIKNRS W Sbjct: 199 PWIEKRVNEGTLNLHGGYYNFVDCTFEKWTLLYREGLEGGSKYAIKNRSTW 249 >ref|XP_021309500.1| beta carbonic anhydrase 5, chloroplastic-like isoform X2 [Sorghum bicolor] gb|KXG35798.1| hypothetical protein SORBI_3002G230100 [Sorghum bicolor] Length = 306 Score = 102 bits (255), Expect = 7e-24 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRV+EGTL LHGGYY+F++CTFEKWTL+YRE LEGGSKYAIKNRS WS Sbjct: 255 PWIEKRVNEGTLNLHGGYYNFIDCTFEKWTLLYREGLEGGSKYAIKNRSTWS 306 >gb|PAN12840.1| hypothetical protein PAHAL_B03130 [Panicum hallii] Length = 308 Score = 102 bits (255), Expect = 8e-24 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRV+EGTL LHGGYY+FV+CTFEKWTLVYR+ LEGGSKYAIKNRS WS Sbjct: 257 PWIEKRVNEGTLNLHGGYYNFVDCTFEKWTLVYRKGLEGGSKYAIKNRSSWS 308 >ref|XP_010939751.1| PREDICTED: beta carbonic anhydrase 5, chloroplastic-like [Elaeis guineensis] Length = 316 Score = 102 bits (255), Expect = 9e-24 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRVSEGTL LHGGYYDFV+CTFEKWTLVYRE L+GGSKY IK+RS WS Sbjct: 265 PWIEKRVSEGTLSLHGGYYDFVDCTFEKWTLVYREGLQGGSKYDIKDRSLWS 316 >ref|XP_004957059.1| beta carbonic anhydrase 5, chloroplastic isoform X2 [Setaria italica] gb|KQL24851.1| hypothetical protein SETIT_030616mg [Setaria italica] Length = 308 Score = 102 bits (254), Expect = 1e-23 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWI+KRV+EGTL LHGGYY+F++CTFEKWTLVYRE LEGGSKYAIKNRS WS Sbjct: 257 PWIKKRVNEGTLNLHGGYYNFIDCTFEKWTLVYREGLEGGSKYAIKNRSTWS 308 >ref|XP_021309499.1| beta carbonic anhydrase 5, chloroplastic-like isoform X1 [Sorghum bicolor] Length = 337 Score = 102 bits (255), Expect = 1e-23 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRV+EGTL LHGGYY+F++CTFEKWTL+YRE LEGGSKYAIKNRS WS Sbjct: 286 PWIEKRVNEGTLNLHGGYYNFIDCTFEKWTLLYREGLEGGSKYAIKNRSTWS 337 >gb|OQU89630.1| hypothetical protein SORBI_3002G230100 [Sorghum bicolor] Length = 337 Score = 102 bits (255), Expect = 1e-23 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +2 Query: 2 PWIEKRVSEGTLYLHGGYYDFVNCTFEKWTLVYRESLEGGSKYAIKNRSFWS 157 PWIEKRV+EGTL LHGGYY+F++CTFEKWTL+YRE LEGGSKYAIKNRS WS Sbjct: 286 PWIEKRVNEGTLNLHGGYYNFIDCTFEKWTLLYREGLEGGSKYAIKNRSTWS 337