BLASTX nr result
ID: Ophiopogon26_contig00025648
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00025648 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247268.1| regulation of nuclear pre-mRNA domain-contai... 64 2e-09 >ref|XP_020247268.1| regulation of nuclear pre-mRNA domain-containing protein 1B [Asparagus officinalis] gb|ONK56141.1| uncharacterized protein A4U43_C10F4560 [Asparagus officinalis] Length = 444 Score = 64.3 bits (155), Expect = 2e-09 Identities = 38/107 (35%), Positives = 45/107 (42%) Frame = -2 Query: 322 SYVFSCLAPEGITSQSMSEDRPSDTSKRPRLNNGSLGNAPCFXXXXXXXXXXXXXXXXXX 143 SYV S L +G+ Q SE+ D SKRPRLNNG+LG+ PCF Sbjct: 334 SYVLSSLVSDGVIGQPTSEEDHPDASKRPRLNNGNLGSVPCFLPQPMLSPTLPL------ 387 Query: 142 XXXXXXXXXXXXXXXXXXXXXSVAGSMSVPPFSYGSPPLHPMPGFPV 2 V PF+YG PP+ PMPGFPV Sbjct: 388 ----------------------------VTPFTYGPPPVPPMPGFPV 406