BLASTX nr result
ID: Ophiopogon26_contig00025515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00025515 (715 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246974.1| (+)-neomenthol dehydrogenase [Asparagus offi... 60 6e-07 >ref|XP_020246974.1| (+)-neomenthol dehydrogenase [Asparagus officinalis] gb|ONK57873.1| uncharacterized protein A4U43_C09F5080 [Asparagus officinalis] Length = 301 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -1 Query: 715 MTRGRGHRTXXXXXESGASIAMLPPNELPSGVFFKISTPSITSKL 581 MT G+GHRT E G+ IA+LPPNELP+G FFKI PSITSKL Sbjct: 257 MTGGKGHRTAAEAAEIGSWIALLPPNELPNGEFFKIPAPSITSKL 301