BLASTX nr result
ID: Ophiopogon26_contig00024477
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00024477 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK79010.1| uncharacterized protein A4U43_C01F1950 [Asparagus... 59 8e-08 ref|XP_020271032.1| splicing factor U2af small subunit B-like [A... 59 1e-07 gb|KZV43085.1| hypothetical protein F511_04477 [Dorcoceras hygro... 59 1e-07 ref|XP_011074052.1| splicing factor U2af small subunit B [Sesamu... 58 2e-07 ref|XP_012839000.1| PREDICTED: splicing factor U2af small subuni... 58 3e-07 gb|EPS71674.1| hypothetical protein M569_03083, partial [Genlise... 57 4e-07 ref|XP_010932132.1| PREDICTED: splicing factor U2af small subuni... 55 2e-06 ref|XP_008796188.1| PREDICTED: splicing factor U2af small subuni... 55 2e-06 gb|PKA51082.1| Splicing factor U2af small subunit B [Apostasia s... 55 3e-06 ref|XP_011041133.1| PREDICTED: splicing factor U2af small subuni... 55 3e-06 ref|XP_015575795.1| PREDICTED: splicing factor U2af small subuni... 55 3e-06 ref|XP_002307825.1| U2 snRNP auxiliary factor small subunit fami... 55 3e-06 ref|XP_022142994.1| splicing factor U2af small subunit B-like [M... 55 3e-06 ref|XP_023525325.1| splicing factor U2af small subunit B-like [C... 55 3e-06 ref|XP_022941119.1| splicing factor U2af small subunit B-like [C... 55 3e-06 ref|XP_009417288.2| PREDICTED: splicing factor U2af small subuni... 55 3e-06 ref|XP_009383225.1| PREDICTED: splicing factor U2af small subuni... 55 3e-06 ref|XP_021686433.1| splicing factor U2af small subunit B-like [H... 55 3e-06 ref|XP_021613742.1| splicing factor U2af small subunit B-like [M... 55 3e-06 ref|XP_012073548.1| splicing factor U2af small subunit B [Jatrop... 55 3e-06 >gb|ONK79010.1| uncharacterized protein A4U43_C01F1950 [Asparagus officinalis] Length = 223 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEKGE 182 R RSPVREGSEERRARI QWNREREEKGE Sbjct: 195 RARSPVREGSEERRARIEQWNREREEKGE 223 >ref|XP_020271032.1| splicing factor U2af small subunit B-like [Asparagus officinalis] Length = 277 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEKGE 182 R RSPVREGSEERRARI QWNREREEKGE Sbjct: 249 RARSPVREGSEERRARIEQWNREREEKGE 277 >gb|KZV43085.1| hypothetical protein F511_04477 [Dorcoceras hygrometricum] Length = 279 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 274 SPRTRSPVREGSEERRARIAQWNREREEKGE 182 S R+RSPVREGSEERRARI QWNREREEKG+ Sbjct: 249 SRRSRSPVREGSEERRARIEQWNREREEKGQ 279 >ref|XP_011074052.1| splicing factor U2af small subunit B [Sesamum indicum] Length = 283 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEKGE 182 R+RSPVREGSEERRARI QWNREREEKG+ Sbjct: 255 RSRSPVREGSEERRARIEQWNREREEKGQ 283 >ref|XP_012839000.1| PREDICTED: splicing factor U2af small subunit B-like [Erythranthe guttata] gb|EYU36603.1| hypothetical protein MIMGU_mgv1a027010mg [Erythranthe guttata] Length = 304 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEKGE 182 R+RSPVREGSEERRARI QWNREREEKG+ Sbjct: 276 RSRSPVREGSEERRARIEQWNREREEKGQ 304 >gb|EPS71674.1| hypothetical protein M569_03083, partial [Genlisea aurea] Length = 278 Score = 57.0 bits (136), Expect = 4e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEKG 185 R+RSPVREGSEERRARI QWNREREEKG Sbjct: 251 RSRSPVREGSEERRARIEQWNREREEKG 278 >ref|XP_010932132.1| PREDICTED: splicing factor U2af small subunit B-like [Elaeis guineensis] Length = 275 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 RTRSPVREGSEERRARI QWNREREE+ Sbjct: 247 RTRSPVREGSEERRARIEQWNREREER 273 >ref|XP_008796188.1| PREDICTED: splicing factor U2af small subunit B-like [Phoenix dactylifera] Length = 276 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 RTRSPVREGSEERRARI QWNREREE+ Sbjct: 248 RTRSPVREGSEERRARIEQWNREREER 274 >gb|PKA51082.1| Splicing factor U2af small subunit B [Apostasia shenzhenica] Length = 269 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 R+RSPVREGSEERRARI QWNREREEK Sbjct: 241 RSRSPVREGSEERRARIEQWNREREEK 267 >ref|XP_011041133.1| PREDICTED: splicing factor U2af small subunit B-like [Populus euphratica] Length = 272 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 R+RSPVREGSEERRARI QWNREREEK Sbjct: 245 RSRSPVREGSEERRARIEQWNREREEK 271 >ref|XP_015575795.1| PREDICTED: splicing factor U2af small subunit B [Ricinus communis] ref|XP_015575808.1| PREDICTED: splicing factor U2af small subunit B [Ricinus communis] ref|XP_015575814.1| PREDICTED: splicing factor U2af small subunit B [Ricinus communis] ref|XP_015575820.1| PREDICTED: splicing factor U2af small subunit B [Ricinus communis] gb|EEF52928.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis] Length = 272 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 R+RSPVREGSEERRARI QWNREREEK Sbjct: 245 RSRSPVREGSEERRARIEQWNREREEK 271 >ref|XP_002307825.1| U2 snRNP auxiliary factor small subunit family protein [Populus trichocarpa] gb|PNT38819.1| hypothetical protein POPTR_005G258000v3 [Populus trichocarpa] Length = 272 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 R+RSPVREGSEERRARI QWNREREEK Sbjct: 245 RSRSPVREGSEERRARIEQWNREREEK 271 >ref|XP_022142994.1| splicing factor U2af small subunit B-like [Momordica charantia] Length = 275 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 R+RSPVREGSEERRARI QWNREREEK Sbjct: 248 RSRSPVREGSEERRARIEQWNREREEK 274 >ref|XP_023525325.1| splicing factor U2af small subunit B-like [Cucurbita pepo subsp. pepo] ref|XP_023525326.1| splicing factor U2af small subunit B-like [Cucurbita pepo subsp. pepo] ref|XP_023525327.1| splicing factor U2af small subunit B-like [Cucurbita pepo subsp. pepo] Length = 276 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 R+RSPVREGSEERRARI QWNREREEK Sbjct: 249 RSRSPVREGSEERRARIEQWNREREEK 275 >ref|XP_022941119.1| splicing factor U2af small subunit B-like [Cucurbita moschata] ref|XP_022941120.1| splicing factor U2af small subunit B-like [Cucurbita moschata] ref|XP_022941121.1| splicing factor U2af small subunit B-like [Cucurbita moschata] ref|XP_022981902.1| splicing factor U2af small subunit B-like [Cucurbita maxima] ref|XP_022981903.1| splicing factor U2af small subunit B-like [Cucurbita maxima] ref|XP_022981905.1| splicing factor U2af small subunit B-like [Cucurbita maxima] Length = 276 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 R+RSPVREGSEERRARI QWNREREEK Sbjct: 249 RSRSPVREGSEERRARIEQWNREREEK 275 >ref|XP_009417288.2| PREDICTED: splicing factor U2af small subunit B-like [Musa acuminata subsp. malaccensis] ref|XP_018674048.1| PREDICTED: splicing factor U2af small subunit B-like [Musa acuminata subsp. malaccensis] ref|XP_018674049.1| PREDICTED: splicing factor U2af small subunit B-like [Musa acuminata subsp. malaccensis] Length = 279 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 277 NSPRTRSPVREGSEERRARIAQWNREREEK 188 N RT+SP+REGSEERRA+I QWNREREEK Sbjct: 248 NPRRTKSPIREGSEERRAKIEQWNREREEK 277 >ref|XP_009383225.1| PREDICTED: splicing factor U2af small subunit B-like [Musa acuminata subsp. malaccensis] ref|XP_009383227.1| PREDICTED: splicing factor U2af small subunit B-like [Musa acuminata subsp. malaccensis] ref|XP_018675612.1| PREDICTED: splicing factor U2af small subunit B-like [Musa acuminata subsp. malaccensis] ref|XP_018675613.1| PREDICTED: splicing factor U2af small subunit B-like [Musa acuminata subsp. malaccensis] ref|XP_018675614.1| PREDICTED: splicing factor U2af small subunit B-like [Musa acuminata subsp. malaccensis] Length = 279 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 RT+SP+REGSEERRARI QWNREREEK Sbjct: 251 RTKSPIREGSEERRARIEQWNREREEK 277 >ref|XP_021686433.1| splicing factor U2af small subunit B-like [Hevea brasiliensis] ref|XP_021686434.1| splicing factor U2af small subunit B-like [Hevea brasiliensis] Length = 280 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 R+RSPVREGSEERRARI QWNREREEK Sbjct: 253 RSRSPVREGSEERRARIEQWNREREEK 279 >ref|XP_021613742.1| splicing factor U2af small subunit B-like [Manihot esculenta] gb|OAY50360.1| hypothetical protein MANES_05G129600 [Manihot esculenta] Length = 280 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 R+RSPVREGSEERRARI QWNREREEK Sbjct: 253 RSRSPVREGSEERRARIEQWNREREEK 279 >ref|XP_012073548.1| splicing factor U2af small subunit B [Jatropha curcas] ref|XP_012073549.1| splicing factor U2af small subunit B [Jatropha curcas] ref|XP_020535387.1| splicing factor U2af small subunit B [Jatropha curcas] ref|XP_020535388.1| splicing factor U2af small subunit B [Jatropha curcas] ref|XP_020535389.1| splicing factor U2af small subunit B [Jatropha curcas] gb|KDP36729.1| hypothetical protein JCGZ_08020 [Jatropha curcas] Length = 280 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 268 RTRSPVREGSEERRARIAQWNREREEK 188 R+RSPVREGSEERRARI QWNREREEK Sbjct: 253 RSRSPVREGSEERRARIEQWNREREEK 279