BLASTX nr result
ID: Ophiopogon26_contig00024291
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00024291 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI79443.1| hypothetical protein CRG98_000190 [Punica granatum] 54 2e-06 ref|XP_020267048.1| vacuolar protein sorting-associated protein ... 54 3e-06 gb|KNA05892.1| hypothetical protein SOVF_186130, partial [Spinac... 52 4e-06 gb|OWM91482.1| hypothetical protein CDL15_Pgr017400 [Punica gran... 54 5e-06 gb|ONK70506.1| uncharacterized protein A4U43_C05F34410 [Asparagu... 54 5e-06 gb|KFK25234.1| hypothetical protein AALP_AA8G085100 [Arabis alpina] 53 7e-06 ref|XP_006288632.1| vacuolar protein sorting-associated protein ... 53 8e-06 ref|XP_024196949.1| vacuolar protein sorting-associated protein ... 53 8e-06 >gb|PKI79443.1| hypothetical protein CRG98_000190 [Punica granatum] Length = 168 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 263 GYIFVKKPKIADVDRATISLKTQHCKLGQYQQR 361 G IFVKKPKI DVDRA +SLKTQ KLGQYQQ+ Sbjct: 2 GNIFVKKPKITDVDRAILSLKTQRRKLGQYQQQ 34 >ref|XP_020267048.1| vacuolar protein sorting-associated protein 20 homolog 2-like [Asparagus officinalis] Length = 216 Score = 54.3 bits (129), Expect = 3e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 263 GYIFVKKPKIADVDRATISLKTQHCKLGQYQQR 361 G IFVKKPKI DVDRA +SLKTQ KLGQYQQ+ Sbjct: 2 GNIFVKKPKITDVDRAILSLKTQRRKLGQYQQK 34 >gb|KNA05892.1| hypothetical protein SOVF_186130, partial [Spinacia oleracea] Length = 117 Score = 52.4 bits (124), Expect = 4e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 263 GYIFVKKPKIADVDRATISLKTQHCKLGQYQQR 361 G IFVKKPKI +VDRA +SLKTQ KLGQYQQ+ Sbjct: 2 GNIFVKKPKITEVDRAILSLKTQRRKLGQYQQQ 34 >gb|OWM91482.1| hypothetical protein CDL15_Pgr017400 [Punica granatum] Length = 250 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 263 GYIFVKKPKIADVDRATISLKTQHCKLGQYQQR 361 G IFVKKPKI DVDRA +SLKTQ KLGQYQQ+ Sbjct: 2 GNIFVKKPKITDVDRAILSLKTQRRKLGQYQQQ 34 >gb|ONK70506.1| uncharacterized protein A4U43_C05F34410 [Asparagus officinalis] Length = 410 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 263 GYIFVKKPKIADVDRATISLKTQHCKLGQYQQR 361 G IFVKKPKI DVDRA +SLKTQ KLGQYQQ+ Sbjct: 2 GNIFVKKPKITDVDRAILSLKTQRRKLGQYQQK 34 >gb|KFK25234.1| hypothetical protein AALP_AA8G085100 [Arabis alpina] Length = 214 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 263 GYIFVKKPKIADVDRATISLKTQHCKLGQYQQR 361 G +FVKKPKI DVDRA +SLKTQ KLGQYQQ+ Sbjct: 2 GNLFVKKPKITDVDRAILSLKTQRRKLGQYQQQ 34 >ref|XP_006288632.1| vacuolar protein sorting-associated protein 20 homolog 2 [Capsella rubella] gb|EOA21530.1| hypothetical protein CARUB_v10001935mg [Capsella rubella] Length = 217 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 263 GYIFVKKPKIADVDRATISLKTQHCKLGQYQQR 361 G +FVKKPKI DVDRA +SLKTQ KLGQYQQ+ Sbjct: 2 GNLFVKKPKITDVDRAILSLKTQRRKLGQYQQQ 34 >ref|XP_024196949.1| vacuolar protein sorting-associated protein 20 homolog 2-like [Rosa chinensis] ref|XP_024196950.1| vacuolar protein sorting-associated protein 20 homolog 2-like [Rosa chinensis] ref|XP_024196951.1| vacuolar protein sorting-associated protein 20 homolog 2-like [Rosa chinensis] gb|PRQ37747.1| putative Snf7 family protein [Rosa chinensis] Length = 220 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 263 GYIFVKKPKIADVDRATISLKTQHCKLGQYQQR 361 G +FVKKPKI DVDRA +SLKTQ KLGQYQQ+ Sbjct: 2 GNLFVKKPKITDVDRAILSLKTQRRKLGQYQQQ 34