BLASTX nr result
ID: Ophiopogon26_contig00024282
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00024282 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244966.1| plant cysteine oxidase 4-like [Asparagus off... 80 2e-15 ref|XP_021854567.1| plant cysteine oxidase 5-like [Spinacia oler... 65 4e-10 ref|XP_021766120.1| plant cysteine oxidase 5-like [Chenopodium q... 65 4e-10 ref|XP_010686214.1| PREDICTED: plant cysteine oxidase 5 [Beta vu... 64 9e-10 ref|XP_010657047.1| PREDICTED: plant cysteine oxidase 4 isoform ... 64 1e-09 ref|XP_020100700.1| plant cysteine oxidase 5-like isoform X2 [An... 63 2e-09 ref|XP_020100694.1| plant cysteine oxidase 4-like isoform X1 [An... 63 2e-09 ref|XP_021599666.1| plant cysteine oxidase 4-like isoform X1 [Ma... 62 4e-09 ref|XP_010999745.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 62 5e-09 ref|XP_010276995.1| PREDICTED: plant cysteine oxidase 5-like iso... 62 6e-09 ref|XP_009415235.1| PREDICTED: plant cysteine oxidase 4 [Musa ac... 62 6e-09 ref|XP_002305065.1| hypothetical protein POPTR_0004s05670g [Popu... 62 6e-09 ref|XP_014517109.1| plant cysteine oxidase 5 [Vigna radiata var.... 62 6e-09 ref|XP_017434112.1| PREDICTED: plant cysteine oxidase 5-like [Vi... 62 6e-09 ref|XP_010999742.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 62 6e-09 ref|XP_010276994.1| PREDICTED: plant cysteine oxidase 5-like iso... 62 6e-09 ref|XP_021723905.1| plant cysteine oxidase 5-like [Chenopodium q... 62 6e-09 ref|XP_018847973.1| PREDICTED: plant cysteine oxidase 4-like [Ju... 61 1e-08 ref|XP_008789374.1| PREDICTED: plant cysteine oxidase 4-like [Ph... 61 2e-08 ref|XP_010924604.1| PREDICTED: plant cysteine oxidase 4 isoform ... 60 2e-08 >ref|XP_020244966.1| plant cysteine oxidase 4-like [Asparagus officinalis] gb|ONK80134.1| uncharacterized protein A4U43_C01F14250 [Asparagus officinalis] Length = 250 Score = 79.7 bits (195), Expect = 2e-15 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPAH 370 MPVI+KLYEACK+SFSPNGP+SAEALEKVRARLDDI+PAH Sbjct: 1 MPVIRKLYEACKASFSPNGPISAEALEKVRARLDDIKPAH 40 >ref|XP_021854567.1| plant cysteine oxidase 5-like [Spinacia oleracea] ref|XP_021854568.1| plant cysteine oxidase 5-like [Spinacia oleracea] gb|KNA19878.1| hypothetical protein SOVF_057340 [Spinacia oleracea] Length = 247 Score = 65.1 bits (157), Expect = 4e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPAH 370 MPV+KK+Y ACK SF+P GP+S EALEKVRA LDD++PA+ Sbjct: 1 MPVLKKIYNACKDSFTPTGPISEEALEKVRAILDDLKPAN 40 >ref|XP_021766120.1| plant cysteine oxidase 5-like [Chenopodium quinoa] Length = 248 Score = 65.1 bits (157), Expect = 4e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPAH 370 MPV+KK+Y ACK SF+P GP+S EALEKVRA LDD++PA+ Sbjct: 1 MPVLKKIYNACKDSFTPTGPISEEALEKVRAILDDLKPAN 40 >ref|XP_010686214.1| PREDICTED: plant cysteine oxidase 5 [Beta vulgaris subsp. vulgaris] gb|KMT04418.1| hypothetical protein BVRB_8g180940 [Beta vulgaris subsp. vulgaris] Length = 248 Score = 64.3 bits (155), Expect = 9e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPAH 370 MPV+KKLY ACK SF+P GP+S EALEKV+A LDD++PA+ Sbjct: 1 MPVLKKLYNACKDSFTPTGPISEEALEKVQAILDDLKPAN 40 >ref|XP_010657047.1| PREDICTED: plant cysteine oxidase 4 isoform X1 [Vitis vinifera] ref|XP_019079214.1| PREDICTED: plant cysteine oxidase 4 isoform X1 [Vitis vinifera] emb|CBI21993.3| unnamed protein product, partial [Vitis vinifera] Length = 239 Score = 63.9 bits (154), Expect = 1e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPA 367 MP I++LY ACKSSFSPNGPVS EALEKVR LD IRP+ Sbjct: 2 MPPIQRLYNACKSSFSPNGPVSEEALEKVRTMLDKIRPS 40 >ref|XP_020100700.1| plant cysteine oxidase 5-like isoform X2 [Ananas comosus] Length = 232 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRP 364 MP I+KLY ACK SFSPNGPVS EALE+VR LDDI+P Sbjct: 1 MPKIRKLYNACKESFSPNGPVSEEALERVRVILDDIKP 38 >ref|XP_020100694.1| plant cysteine oxidase 4-like isoform X1 [Ananas comosus] gb|OAY85142.1| Plant cysteine oxidase 4 [Ananas comosus] Length = 244 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRP 364 MP I+KLY ACK SFSPNGPVS EALE+VR LDDI+P Sbjct: 1 MPKIRKLYNACKESFSPNGPVSEEALERVRVILDDIKP 38 >ref|XP_021599666.1| plant cysteine oxidase 4-like isoform X1 [Manihot esculenta] ref|XP_021599667.1| plant cysteine oxidase 4-like isoform X1 [Manihot esculenta] ref|XP_021599668.1| plant cysteine oxidase 4-like isoform X1 [Manihot esculenta] ref|XP_021599669.1| plant cysteine oxidase 4-like isoform X1 [Manihot esculenta] ref|XP_021599670.1| plant cysteine oxidase 4-like isoform X1 [Manihot esculenta] ref|XP_021599671.1| plant cysteine oxidase 4-like isoform X1 [Manihot esculenta] ref|XP_021599672.1| plant cysteine oxidase 4-like isoform X1 [Manihot esculenta] ref|XP_021599673.1| plant cysteine oxidase 4-like isoform X1 [Manihot esculenta] ref|XP_021599674.1| plant cysteine oxidase 4-like isoform X1 [Manihot esculenta] gb|OAY24952.1| hypothetical protein MANES_17G056700 [Manihot esculenta] gb|OAY24953.1| hypothetical protein MANES_17G056700 [Manihot esculenta] gb|OAY24954.1| hypothetical protein MANES_17G056700 [Manihot esculenta] gb|OAY24955.1| hypothetical protein MANES_17G056700 [Manihot esculenta] gb|OAY24956.1| hypothetical protein MANES_17G056700 [Manihot esculenta] gb|OAY24957.1| hypothetical protein MANES_17G056700 [Manihot esculenta] Length = 245 Score = 62.4 bits (150), Expect = 4e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPAH 370 MPV++KLY+ACK SFS NGPVS EALEKVRA LD ++P++ Sbjct: 1 MPVVQKLYDACKESFSTNGPVSEEALEKVRAILDQMKPSN 40 >ref|XP_010999745.1| PREDICTED: 2-aminoethanethiol dioxygenase-like isoform X2 [Populus euphratica] Length = 232 Score = 62.0 bits (149), Expect = 5e-09 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPAH 370 MPV++KLY+ACK SFS NGPVS EALEK+RA LD ++P++ Sbjct: 1 MPVVQKLYDACKESFSANGPVSEEALEKIRAILDQMKPSN 40 >ref|XP_010276995.1| PREDICTED: plant cysteine oxidase 5-like isoform X6 [Nelumbo nucifera] Length = 242 Score = 62.0 bits (149), Expect = 6e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPA 367 MP I++LYEACK SFSPNGPVS EALE+VR LD IRP+ Sbjct: 1 MPFIQRLYEACKVSFSPNGPVSDEALERVRVLLDTIRPS 39 >ref|XP_009415235.1| PREDICTED: plant cysteine oxidase 4 [Musa acuminata subsp. malaccensis] Length = 242 Score = 62.0 bits (149), Expect = 6e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPA 367 MP IK+LY+ACK SFS NGP+SAEALE VR+ LDDI+P+ Sbjct: 1 MPAIKRLYDACKMSFSDNGPISAEALEYVRSVLDDIKPS 39 >ref|XP_002305065.1| hypothetical protein POPTR_0004s05670g [Populus trichocarpa] gb|PNT39764.1| hypothetical protein POPTR_004G058000v3 [Populus trichocarpa] gb|PNT39766.1| hypothetical protein POPTR_004G058000v3 [Populus trichocarpa] Length = 245 Score = 62.0 bits (149), Expect = 6e-09 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPAH 370 MPV++KLY+ACK SFS NGPVS EALEK+RA LD ++P++ Sbjct: 1 MPVVQKLYDACKESFSANGPVSEEALEKIRAILDQMKPSN 40 >ref|XP_014517109.1| plant cysteine oxidase 5 [Vigna radiata var. radiata] ref|XP_022642664.1| plant cysteine oxidase 5 [Vigna radiata var. radiata] ref|XP_022642665.1| plant cysteine oxidase 5 [Vigna radiata var. radiata] Length = 246 Score = 62.0 bits (149), Expect = 6e-09 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPAH 370 MP+++KLY+ CK+S SP GP+S EALEKVRA LDD++P++ Sbjct: 1 MPIVQKLYDTCKASLSPEGPISEEALEKVRALLDDLKPSN 40 >ref|XP_017434112.1| PREDICTED: plant cysteine oxidase 5-like [Vigna angularis] ref|XP_017434113.1| PREDICTED: plant cysteine oxidase 5-like [Vigna angularis] gb|KOM53674.1| hypothetical protein LR48_Vigan09g233300 [Vigna angularis] dbj|BAT87196.1| hypothetical protein VIGAN_05054000 [Vigna angularis var. angularis] Length = 246 Score = 62.0 bits (149), Expect = 6e-09 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPAH 370 MP+++KLY+ CK+S SP GP+S EALEKVRA LDD++P++ Sbjct: 1 MPIVQKLYDTCKASLSPEGPISEEALEKVRALLDDLKPSN 40 >ref|XP_010999742.1| PREDICTED: 2-aminoethanethiol dioxygenase-like isoform X1 [Populus euphratica] ref|XP_010999743.1| PREDICTED: 2-aminoethanethiol dioxygenase-like isoform X1 [Populus euphratica] ref|XP_010999744.1| PREDICTED: 2-aminoethanethiol dioxygenase-like isoform X1 [Populus euphratica] Length = 247 Score = 62.0 bits (149), Expect = 6e-09 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPAH 370 MPV++KLY+ACK SFS NGPVS EALEK+RA LD ++P++ Sbjct: 1 MPVVQKLYDACKESFSANGPVSEEALEKIRAILDQMKPSN 40 >ref|XP_010276994.1| PREDICTED: plant cysteine oxidase 5-like isoform X5 [Nelumbo nucifera] Length = 247 Score = 62.0 bits (149), Expect = 6e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPA 367 MP I++LYEACK SFSPNGPVS EALE+VR LD IRP+ Sbjct: 1 MPFIQRLYEACKVSFSPNGPVSDEALERVRVLLDTIRPS 39 >ref|XP_021723905.1| plant cysteine oxidase 5-like [Chenopodium quinoa] Length = 248 Score = 62.0 bits (149), Expect = 6e-09 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPAH 370 MPV+KK+Y ACK SF+P GP+S EAL+KVRA LDD++P + Sbjct: 1 MPVMKKIYNACKDSFTPTGPISEEALDKVRAILDDLKPVN 40 >ref|XP_018847973.1| PREDICTED: plant cysteine oxidase 4-like [Juglans regia] ref|XP_018847974.1| PREDICTED: plant cysteine oxidase 4-like [Juglans regia] Length = 244 Score = 61.2 bits (147), Expect = 1e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPA 367 MPVI+KLY+ACK SFS NGP+S E+L KVRA LDD+RP+ Sbjct: 1 MPVIQKLYDACKVSFSSNGPISEESLGKVRAILDDLRPS 39 >ref|XP_008789374.1| PREDICTED: plant cysteine oxidase 4-like [Phoenix dactylifera] ref|XP_008789376.1| PREDICTED: plant cysteine oxidase 4-like [Phoenix dactylifera] Length = 243 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPA 367 MP I++LY+ACK SFSPNGP+S EALE+VR LD+IRP+ Sbjct: 1 MPAIQRLYDACKVSFSPNGPISPEALEQVRFILDEIRPS 39 >ref|XP_010924604.1| PREDICTED: plant cysteine oxidase 4 isoform X2 [Elaeis guineensis] Length = 219 Score = 60.5 bits (145), Expect = 2e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +2 Query: 251 MPVIKKLYEACKSSFSPNGPVSAEALEKVRARLDDIRPA 367 MP I++LY+ACK SF PNGPVS EALE+VR+ LD+IRP+ Sbjct: 1 MPAIQRLYDACKVSFCPNGPVSPEALEQVRSILDEIRPS 39