BLASTX nr result
ID: Ophiopogon26_contig00023922
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00023922 (758 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK22817.1| unknown [Picea sitchensis] 60 5e-07 gb|KDO62086.1| hypothetical protein CISIN_1g0259872mg, partial [... 57 5e-07 gb|ABK22393.1| unknown [Picea sitchensis] 60 6e-07 gb|OAY72928.1| Proline synthase co-transcribed bacterial protein... 58 7e-07 gb|KDO62085.1| hypothetical protein CISIN_1g0259872mg, partial [... 57 2e-06 gb|ONK81480.1| uncharacterized protein A4U43_C01F29580 [Asparagu... 57 2e-06 ref|XP_009392906.1| PREDICTED: proline synthase co-transcribed b... 58 3e-06 ref|XP_020114385.1| proline synthase co-transcribed bacterial ho... 58 3e-06 dbj|GAV61246.1| Ala_racemase_N domain-containing protein [Cephal... 58 4e-06 gb|KNA24914.1| hypothetical protein SOVF_011240, partial [Spinac... 56 4e-06 gb|KDO62084.1| hypothetical protein CISIN_1g0259872mg, partial [... 57 4e-06 gb|PHU04125.1| Proline synthase co-transcribed bacterial -like p... 57 4e-06 gb|PHT35448.1| Proline synthase co-transcribed bacterial -like p... 57 4e-06 ref|XP_019196251.1| PREDICTED: proline synthase co-transcribed b... 57 4e-06 ref|XP_016537572.1| PREDICTED: proline synthase co-transcribed b... 57 4e-06 gb|PHT69586.1| Proline synthase co-transcribed bacterial -like p... 57 4e-06 ref|XP_015633552.1| PREDICTED: proline synthase co-transcribed b... 57 4e-06 ref|XP_024034476.1| pyridoxal phosphate homeostasis protein isof... 57 5e-06 ref|XP_015384599.1| PREDICTED: proline synthase co-transcribed b... 57 5e-06 gb|KDO62083.1| hypothetical protein CISIN_1g0259872mg [Citrus si... 57 5e-06 >gb|ABK22817.1| unknown [Picea sitchensis] Length = 218 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 651 ITTFQIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 + + ++ANHLDRAVSSIGRK LKVLVQVNTSGEESK Sbjct: 103 VDSSKVANHLDRAVSSIGRKPLKVLVQVNTSGEESK 138 >gb|KDO62086.1| hypothetical protein CISIN_1g0259872mg, partial [Citrus sinensis] gb|KDO62087.1| hypothetical protein CISIN_1g0259872mg, partial [Citrus sinensis] Length = 83 Score = 56.6 bits (135), Expect = 5e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 +IANHLD+AVS++GRK LKVLVQVNTSGEESK Sbjct: 9 KIANHLDKAVSNLGRKPLKVLVQVNTSGEESK 40 >gb|ABK22393.1| unknown [Picea sitchensis] Length = 244 Score = 59.7 bits (143), Expect = 6e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 651 ITTFQIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 + + ++ANHLDRAVSSIGRK LKVLVQVNTSGEESK Sbjct: 109 VDSSKVANHLDRAVSSIGRKPLKVLVQVNTSGEESK 144 >gb|OAY72928.1| Proline synthase co-transcribed bacterial protein [Ananas comosus] Length = 142 Score = 57.8 bits (138), Expect = 7e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 +IANHLDRAV+S+GRK LKVLVQVNTSGEESK Sbjct: 9 KIANHLDRAVASLGRKPLKVLVQVNTSGEESK 40 >gb|KDO62085.1| hypothetical protein CISIN_1g0259872mg, partial [Citrus sinensis] Length = 140 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 +IANHLD+AVS++GRK LKVLVQVNTSGEESK Sbjct: 66 KIANHLDKAVSNLGRKPLKVLVQVNTSGEESK 97 >gb|ONK81480.1| uncharacterized protein A4U43_C01F29580 [Asparagus officinalis] Length = 156 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 +IANHLDRAV+++GRK LKVLVQVNTSGEESK Sbjct: 22 KIANHLDRAVANLGRKPLKVLVQVNTSGEESK 53 >ref|XP_009392906.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Musa acuminata subsp. malaccensis] Length = 248 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 +IANHLDRAV+S+GRK LKVLVQVNTSGEESK Sbjct: 114 KIANHLDRAVASLGRKPLKVLVQVNTSGEESK 145 >ref|XP_020114385.1| proline synthase co-transcribed bacterial homolog protein-like [Ananas comosus] Length = 250 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 +IANHLDRAV+S+GRK LKVLVQVNTSGEESK Sbjct: 117 KIANHLDRAVASLGRKPLKVLVQVNTSGEESK 148 >dbj|GAV61246.1| Ala_racemase_N domain-containing protein [Cephalotus follicularis] Length = 269 Score = 57.8 bits (138), Expect = 4e-06 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 +IANHLDRAV+S+GRK LKVLVQVNTSGEESK Sbjct: 138 KIANHLDRAVASLGRKPLKVLVQVNTSGEESK 169 >gb|KNA24914.1| hypothetical protein SOVF_011240, partial [Spinacia oleracea] Length = 146 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +3 Query: 630 HYNNYLDITTFQIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 H + + + ++ANHLDRAVS+IGRK LKVLVQVNTSGE SK Sbjct: 4 HLDMVHGVDSQKLANHLDRAVSAIGRKPLKVLVQVNTSGETSK 46 >gb|KDO62084.1| hypothetical protein CISIN_1g0259872mg, partial [Citrus sinensis] Length = 186 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 +IANHLD+AVS++GRK LKVLVQVNTSGEESK Sbjct: 112 KIANHLDKAVSNLGRKPLKVLVQVNTSGEESK 143 >gb|PHU04125.1| Proline synthase co-transcribed bacterial -like protein [Capsicum chinense] Length = 243 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 ++ANHLDRAVSSIGR+ LKVLVQVNTSGEESK Sbjct: 112 KLANHLDRAVSSIGRQPLKVLVQVNTSGEESK 143 >gb|PHT35448.1| Proline synthase co-transcribed bacterial -like protein [Capsicum baccatum] Length = 243 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 ++ANHLDRAVSSIGR+ LKVLVQVNTSGEESK Sbjct: 112 KLANHLDRAVSSIGRQPLKVLVQVNTSGEESK 143 >ref|XP_019196251.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Ipomoea nil] Length = 243 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 ++ANHLDRA+SSIGR+ LKVLVQVNTSGEESK Sbjct: 112 KVANHLDRAISSIGRQPLKVLVQVNTSGEESK 143 >ref|XP_016537572.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Capsicum annuum] Length = 243 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 ++ANHLDRAVSSIGR+ LKVLVQVNTSGEESK Sbjct: 112 KLANHLDRAVSSIGRQPLKVLVQVNTSGEESK 143 >gb|PHT69586.1| Proline synthase co-transcribed bacterial -like protein [Capsicum annuum] Length = 252 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 ++ANHLDRAVSSIGR+ LKVLVQVNTSGEESK Sbjct: 121 KLANHLDRAVSSIGRQPLKVLVQVNTSGEESK 152 >ref|XP_015633552.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein isoform X3 [Oryza sativa Japonica Group] Length = 225 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 651 ITTFQIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 + +IANHLDRAVSS+GR LKVLVQVNTSGEESK Sbjct: 108 VDNVKIANHLDRAVSSLGRDPLKVLVQVNTSGEESK 143 >ref|XP_024034476.1| pyridoxal phosphate homeostasis protein isoform X3 [Citrus clementina] Length = 199 Score = 56.6 bits (135), Expect = 5e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 +IANHLD+AVS++GRK LKVLVQVNTSGEESK Sbjct: 66 KIANHLDKAVSNLGRKPLKVLVQVNTSGEESK 97 >ref|XP_015384599.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein isoform X3 [Citrus sinensis] Length = 199 Score = 56.6 bits (135), Expect = 5e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 +IANHLD+AVS++GRK LKVLVQVNTSGEESK Sbjct: 66 KIANHLDKAVSNLGRKPLKVLVQVNTSGEESK 97 >gb|KDO62083.1| hypothetical protein CISIN_1g0259872mg [Citrus sinensis] Length = 200 Score = 56.6 bits (135), Expect = 5e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 663 QIANHLDRAVSSIGRKALKVLVQVNTSGEESK 758 +IANHLD+AVS++GRK LKVLVQVNTSGEESK Sbjct: 112 KIANHLDKAVSNLGRKPLKVLVQVNTSGEESK 143