BLASTX nr result
ID: Ophiopogon26_contig00023841
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00023841 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004980242.1| senescence-specific cysteine protease SAG39-... 56 8e-07 ref|XP_004980241.1| senescence-specific cysteine protease SAG39 ... 56 1e-06 ref|XP_004978889.1| senescence-specific cysteine protease SAG39 ... 56 1e-06 gb|ONK81585.1| uncharacterized protein A4U43_C01F30820 [Asparagu... 56 2e-06 ref|XP_020268788.1| senescence-specific cysteine protease SAG39-... 55 4e-06 gb|PHT90386.1| Senescence-specific cysteine protease SAG39 [Caps... 54 9e-06 >ref|XP_004980242.1| senescence-specific cysteine protease SAG39-like [Setaria italica] Length = 222 Score = 56.2 bits (134), Expect = 8e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 317 GCCWAFSAVAAIEGIHHIKTGQLTSL 394 GCCWAFSAVAAIEGIHHIKTG+L SL Sbjct: 35 GCCWAFSAVAAIEGIHHIKTGELVSL 60 >ref|XP_004980241.1| senescence-specific cysteine protease SAG39 [Setaria italica] gb|KQK93899.1| hypothetical protein SETIT_027295mg [Setaria italica] Length = 349 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 317 GCCWAFSAVAAIEGIHHIKTGQLTSL 394 GCCWAFSAVAAIEGIHHIKTG+L SL Sbjct: 162 GCCWAFSAVAAIEGIHHIKTGELVSL 187 >ref|XP_004978889.1| senescence-specific cysteine protease SAG39 [Setaria italica] ref|XP_004978890.1| senescence-specific cysteine protease SAG39 [Setaria italica] ref|XP_004978891.1| senescence-specific cysteine protease SAG39 [Setaria italica] ref|XP_004978892.1| senescence-specific cysteine protease SAG39 [Setaria italica] gb|KQK93900.1| hypothetical protein SETIT_027274mg [Setaria italica] gb|KQK93901.1| hypothetical protein SETIT_028315mg [Setaria italica] gb|KQK93902.1| hypothetical protein SETIT_027399mg [Setaria italica] gb|KQK93903.1| hypothetical protein SETIT_027514mg [Setaria italica] Length = 349 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 317 GCCWAFSAVAAIEGIHHIKTGQLTSL 394 GCCWAFSAVAAIEGIHHIKTG+L SL Sbjct: 162 GCCWAFSAVAAIEGIHHIKTGELVSL 187 >gb|ONK81585.1| uncharacterized protein A4U43_C01F30820 [Asparagus officinalis] Length = 446 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 293 YAFRIDKIGCCWAFSAVAAIEGIHHIKTGQLTSL 394 YAF +GCCWAFSAVAAIEGIH IKTG+LTSL Sbjct: 245 YAF---VLGCCWAFSAVAAIEGIHQIKTGELTSL 275 >ref|XP_020268788.1| senescence-specific cysteine protease SAG39-like [Asparagus officinalis] Length = 338 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 317 GCCWAFSAVAAIEGIHHIKTGQLTSL 394 GCCWAFSAVAAIEGIH IKTG+LTSL Sbjct: 142 GCCWAFSAVAAIEGIHQIKTGELTSL 167 >gb|PHT90386.1| Senescence-specific cysteine protease SAG39 [Capsicum annuum] Length = 249 Score = 53.5 bits (127), Expect = 9e-06 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 23/100 (23%) Frame = +2 Query: 164 NFAFIRAF*ILYTSYCVTIHKTNRYSHNSCYHELCHHKISNRNYAFRIDKI--------- 316 N A IR + + + ++ R +HN +++ H+ S+R +FR + + Sbjct: 73 NKAGIRPYKLSINGFADLTNEEFRATHNG--YKMSSHRESSRTISFRHENVTAPATMDWR 130 Query: 317 --------------GCCWAFSAVAAIEGIHHIKTGQLTSL 394 GCCWAFSAVAAIEGI+ IKTG+L SL Sbjct: 131 NKGAVTGVKDQGQCGCCWAFSAVAAIEGINKIKTGKLVSL 170