BLASTX nr result
ID: Ophiopogon26_contig00023830
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00023830 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020243976.1| cyclin-A3-1-like isoform X2 [Asparagus offic... 60 1e-07 ref|XP_003578446.1| PREDICTED: cyclin-A3-2-like [Brachypodium di... 58 6e-07 ref|NP_001147065.1| cyclin-A2 [Zea mays] >gi|195607004|gb|ACG253... 57 1e-06 ref|XP_023157815.1| cyclin-A2 isoform X1 [Zea mays] 57 1e-06 ref|XP_020243975.1| cyclin-A3-1-like isoform X1 [Asparagus offic... 55 5e-06 ref|XP_020095438.1| LOW QUALITY PROTEIN: cyclin-A3-1-like [Anana... 55 7e-06 ref|XP_020177944.1| cyclin-A3-2-like [Aegilops tauschii subsp. t... 55 7e-06 ref|XP_002442399.1| cyclin-A3-2 [Sorghum bicolor] >gi|241943092|... 55 8e-06 >ref|XP_020243976.1| cyclin-A3-1-like isoform X2 [Asparagus officinalis] gb|ONK60020.1| uncharacterized protein A4U43_C08F13370 [Asparagus officinalis] Length = 358 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -3 Query: 432 DLQLSRKRYCSSGIREKYNQDRFKCVSTLLPPLKIPTFYFEGF 304 DLQL++K+ + +REKY Q +FK V+TL+PPL+IPT YFEGF Sbjct: 316 DLQLNKKKSSLTAVREKYKQHKFKFVTTLVPPLEIPTSYFEGF 358 >ref|XP_003578446.1| PREDICTED: cyclin-A3-2-like [Brachypodium distachyon] gb|KQJ86127.1| hypothetical protein BRADI_4g03470v3 [Brachypodium distachyon] Length = 381 Score = 57.8 bits (138), Expect = 6e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 432 DLQLSRKRYCSSGIREKYNQDRFKCVSTLLPPLKIPTFYFE 310 DLQL+RK + IR+KY Q RFKCVSTLLPP++IP YF+ Sbjct: 338 DLQLNRKGLSLTAIRDKYKQHRFKCVSTLLPPVEIPASYFQ 378 >ref|NP_001147065.1| cyclin-A2 [Zea mays] gb|ACG25332.1| cyclin-A2 [Zea mays] gb|ONM01605.1| Cyclin-A2 [Zea mays] Length = 423 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 432 DLQLSRKRYCSSGIREKYNQDRFKCVSTLLPPLKIPTFYFE 310 DLQL+RK + IR+KY Q +FKCVSTLLPP+ +PT YFE Sbjct: 379 DLQLNRKFPSLTAIRDKYKQHKFKCVSTLLPPVVVPTSYFE 419 >ref|XP_023157815.1| cyclin-A2 isoform X1 [Zea mays] Length = 431 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 432 DLQLSRKRYCSSGIREKYNQDRFKCVSTLLPPLKIPTFYFE 310 DLQL+RK + IR+KY Q +FKCVSTLLPP+ +PT YFE Sbjct: 387 DLQLNRKFPSLTAIRDKYKQHKFKCVSTLLPPVVVPTSYFE 427 >ref|XP_020243975.1| cyclin-A3-1-like isoform X1 [Asparagus officinalis] Length = 359 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/44 (59%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -3 Query: 432 DLQLSRKRYCSSGIREKYNQDR-FKCVSTLLPPLKIPTFYFEGF 304 DLQL++K+ + +REKY Q + FK V+TL+PPL+IPT YFEGF Sbjct: 316 DLQLNKKKSSLTAVREKYKQHKQFKFVTTLVPPLEIPTSYFEGF 359 >ref|XP_020095438.1| LOW QUALITY PROTEIN: cyclin-A3-1-like [Ananas comosus] Length = 373 Score = 54.7 bits (130), Expect = 7e-06 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = -3 Query: 432 DLQLSRKRYCSSGIREKYNQDRFKCVSTLLPPLKIPTFYFEGF*G 298 DLQL+RK IREKY Q RFKCVS+LL P +IP YF+ F G Sbjct: 329 DLQLNRKGSNLVAIREKYKQHRFKCVSSLLSPQEIPALYFDNFKG 373 >ref|XP_020177944.1| cyclin-A3-2-like [Aegilops tauschii subsp. tauschii] Length = 378 Score = 54.7 bits (130), Expect = 7e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -3 Query: 432 DLQLSRKRYCSSGIREKYNQDRFKCVSTLLPPLKIPTFYFE 310 DLQL+RK IR+KY Q RFKCVS LLPP++IP YF+ Sbjct: 334 DLQLNRKGQSLPAIRDKYKQHRFKCVSMLLPPVEIPASYFQ 374 >ref|XP_002442399.1| cyclin-A3-2 [Sorghum bicolor] gb|EES16237.1| hypothetical protein SORBI_3008G143800 [Sorghum bicolor] gb|OQU79434.1| hypothetical protein SORBI_3008G143800 [Sorghum bicolor] Length = 428 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -3 Query: 432 DLQLSRKRYCSSGIREKYNQDRFKCVSTLLPPLKIPTFYFE 310 DLQL+RK IR+KY Q +FKCVSTLLPP+ IP YFE Sbjct: 384 DLQLNRKCPSLMAIRDKYKQHKFKCVSTLLPPVVIPASYFE 424