BLASTX nr result
ID: Ophiopogon26_contig00023790
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00023790 (921 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAY67095.1| Zinc-finger homeodomain protein 11 [Ananas comosus] 57 5e-06 ref|XP_021318359.1| zinc-finger homeodomain protein 8 [Sorghum b... 58 6e-06 ref|XP_003579781.1| PREDICTED: zinc-finger homeodomain protein 8... 57 9e-06 >gb|OAY67095.1| Zinc-finger homeodomain protein 11 [Ananas comosus] Length = 189 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = -2 Query: 635 REMAEERNQNLQCMRSHGAGHGTYSFDGCSKFYSSE--PTNLWCDACGCHRRNHLKV 471 RE +R +CMR+H A GTY+ DGC ++ + E P +L C ACGCHR H KV Sbjct: 3 RERVVQREVYKECMRNHAAKLGTYAADGCCEYTADEARPGSLSCAACGCHRNFHRKV 59 >ref|XP_021318359.1| zinc-finger homeodomain protein 8 [Sorghum bicolor] Length = 327 Score = 58.2 bits (139), Expect = 6e-06 Identities = 23/46 (50%), Positives = 31/46 (67%) Frame = -2 Query: 602 QCMRSHGAGHGTYSFDGCSKFYSSEPTNLWCDACGCHRRNHLKVAA 465 +CMR+H A G +FDGC ++ +S P +L C ACGCHR H + AA Sbjct: 32 ECMRNHAAAMGGQAFDGCGEYMASSPDSLKCAACGCHRSFHRRAAA 77 >ref|XP_003579781.1| PREDICTED: zinc-finger homeodomain protein 8-like [Brachypodium distachyon] gb|KQJ82687.1| hypothetical protein BRADI_5g10470v3 [Brachypodium distachyon] Length = 285 Score = 57.4 bits (137), Expect = 9e-06 Identities = 23/46 (50%), Positives = 31/46 (67%) Frame = -2 Query: 602 QCMRSHGAGHGTYSFDGCSKFYSSEPTNLWCDACGCHRRNHLKVAA 465 +CMR+H A G +FDGC ++ S+ P +L C ACGCHR H + AA Sbjct: 25 ECMRNHAAAMGGQAFDGCGEYMSASPDSLSCAACGCHRSFHRRQAA 70