BLASTX nr result
ID: Ophiopogon26_contig00023768
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00023768 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY38835.1| hypothetical protein RhiirA4_392562 [Rhizophagus ... 60 1e-07 gb|EXX50337.1| hypothetical protein RirG_271820 [Rhizophagus irr... 60 1e-07 gb|PKK69295.1| hypothetical protein RhiirC2_748668 [Rhizophagus ... 57 1e-06 dbj|GBC33920.1| membrane protein [Rhizophagus irregularis DAOM 1... 55 2e-06 gb|POG77664.1| hypothetical protein GLOIN_2v1544686 [Rhizophagus... 55 4e-06 >gb|PKY38835.1| hypothetical protein RhiirA4_392562 [Rhizophagus irregularis] Length = 274 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 151 MSSVRDESGQSPSTTTAPNQYQYEVKLTRKE 59 MSSV++ESGQSPSTTTAPNQY YEVKLTRKE Sbjct: 1 MSSVKNESGQSPSTTTAPNQYPYEVKLTRKE 31 >gb|EXX50337.1| hypothetical protein RirG_271820 [Rhizophagus irregularis DAOM 197198w] dbj|GBC24216.1| membrane protein [Rhizophagus irregularis DAOM 181602] gb|PKC04688.1| hypothetical protein RhiirA5_362062 [Rhizophagus irregularis] gb|PKC72768.1| hypothetical protein RhiirA1_411413 [Rhizophagus irregularis] gb|PKY16826.1| hypothetical protein RhiirB3_403393 [Rhizophagus irregularis] gb|POG82593.1| hypothetical protein GLOIN_2v1496390 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 274 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 151 MSSVRDESGQSPSTTTAPNQYQYEVKLTRKE 59 MSSV++ESGQSPSTTTAPNQY YEVKLTRKE Sbjct: 1 MSSVKNESGQSPSTTTAPNQYPYEVKLTRKE 31 >gb|PKK69295.1| hypothetical protein RhiirC2_748668 [Rhizophagus irregularis] Length = 274 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 151 MSSVRDESGQSPSTTTAPNQYQYEVKLTRKE 59 MSSV++ES QSPSTTTAPNQY YEVKLTRKE Sbjct: 1 MSSVKNESEQSPSTTTAPNQYPYEVKLTRKE 31 >dbj|GBC33920.1| membrane protein [Rhizophagus irregularis DAOM 181602] Length = 186 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 151 MSSVRDESGQSPSTTTAPNQYQYEVKLTRKE 59 MSSVRD+SGQSPSTTT NQY +EVKLTRKE Sbjct: 1 MSSVRDKSGQSPSTTTTTNQYPFEVKLTRKE 31 >gb|POG77664.1| hypothetical protein GLOIN_2v1544686 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 227 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 151 MSSVRDESGQSPSTTTAPNQYQYEVKLTRKE 59 MSSVRD+SGQSPSTTT NQY +EVKLTRKE Sbjct: 1 MSSVRDKSGQSPSTTTTTNQYPFEVKLTRKE 31