BLASTX nr result
ID: Ophiopogon26_contig00023745
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00023745 (486 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242946.1| uncharacterized protein LOC109821168 [Aspara... 60 1e-07 ref|XP_020270910.1| uncharacterized protein LOC109846096 [Aspara... 59 4e-07 ref|XP_020242930.1| uncharacterized protein LOC109821149 [Aspara... 58 6e-07 ref|XP_020243711.1| uncharacterized protein LOC109821969 [Aspara... 58 7e-07 ref|XP_020243014.1| zinc finger CCHC domain-containing protein 9... 55 9e-07 ref|XP_020245436.1| uncharacterized protein LOC109823570 [Aspara... 57 1e-06 gb|KND56555.1| hypothetical protein BVER_03567 [Candidatus Burkh... 57 1e-06 dbj|GAV79913.1| zf-CCHC domain-containing protein [Cephalotus fo... 55 1e-06 ref|XP_010666861.1| PREDICTED: cellular nucleic acid-binding pro... 54 2e-06 dbj|GAV75697.1| zf-CCHC domain-containing protein/RVP_2 domain-c... 56 3e-06 dbj|GAV73004.1| zf-CCHC domain-containing protein/zf-CCHC_4 doma... 53 3e-06 dbj|GAV92888.1| zf-CCHC domain-containing protein/zf-CCHC_4 doma... 54 4e-06 dbj|GAV91168.1| zf-CCHC domain-containing protein/zf-CCHC_4 doma... 53 4e-06 dbj|GAV91557.1| zf-CCHC domain-containing protein [Cephalotus fo... 54 4e-06 dbj|GAV79570.1| zf-CCHC domain-containing protein [Cephalotus fo... 54 4e-06 ref|XP_010674863.1| PREDICTED: cold shock protein 1-like [Beta v... 54 5e-06 dbj|GAV83813.1| zf-CCHC domain-containing protein [Cephalotus fo... 53 5e-06 dbj|GAV63112.1| zf-CCHC domain-containing protein [Cephalotus fo... 53 6e-06 dbj|GAV68742.1| zf-CCHC domain-containing protein [Cephalotus fo... 54 6e-06 dbj|GAV70738.1| zf-CCHC domain-containing protein/zf-CCHC_4 doma... 53 6e-06 >ref|XP_020242946.1| uncharacterized protein LOC109821168 [Asparagus officinalis] Length = 348 Score = 60.1 bits (144), Expect = 1e-07 Identities = 23/47 (48%), Positives = 31/47 (65%) Frame = -3 Query: 484 IICSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCPIPRQGAGAPG 344 +IC YC +PGH+ ++CR+A+G CL CGA DH + CP R A G Sbjct: 1 MICHYCKKPGHLMKDCRKANGLCLICGAADHQLTTCPSRRVSGEASG 47 >ref|XP_020270910.1| uncharacterized protein LOC109846096 [Asparagus officinalis] Length = 583 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/47 (46%), Positives = 31/47 (65%) Frame = -3 Query: 484 IICSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCPIPRQGAGAPG 344 ++C YC +PGH+ ++C +A+G CL CGA DH + CP R GA G Sbjct: 266 MVCHYCKKPGHLMKDCWKANGLCLICGAADHQLTTCPSRRVPGGASG 312 >ref|XP_020242930.1| uncharacterized protein LOC109821149 [Asparagus officinalis] Length = 244 Score = 57.8 bits (138), Expect = 6e-07 Identities = 19/37 (51%), Positives = 27/37 (72%) Frame = -3 Query: 484 IICSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 +IC +C +PGH+ ++CRRA+ CL CG PDH + CP Sbjct: 191 LICHFCSKPGHLMKDCRRANRLCLACGVPDHQITTCP 227 >ref|XP_020243711.1| uncharacterized protein LOC109821969 [Asparagus officinalis] Length = 352 Score = 58.2 bits (139), Expect = 7e-07 Identities = 20/37 (54%), Positives = 29/37 (78%) Frame = -3 Query: 484 IICSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 +IC +C +PGH+ ++CRRA+G CL CGA DH ++ CP Sbjct: 292 MICHFCSKPGHLMKDCRRANGLCLACGAVDHQLSTCP 328 >ref|XP_020243014.1| zinc finger CCHC domain-containing protein 9-like [Asparagus officinalis] Length = 101 Score = 54.7 bits (130), Expect = 9e-07 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -3 Query: 484 IICSYCHRPGHVRRECRRASGACLRCGAPDHTVAQC 377 +IC +C +PGH+ ++CRRA+G CL CG DH + C Sbjct: 48 MICHFCSKPGHLMKDCRRANGLCLACGVADHQITTC 83 >ref|XP_020245436.1| uncharacterized protein LOC109823570 [Asparagus officinalis] Length = 342 Score = 57.4 bits (137), Expect = 1e-06 Identities = 21/48 (43%), Positives = 30/48 (62%) Frame = -3 Query: 484 IICSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCPIPRQGAGAPGQ 341 +IC +C +PGH+ ++CRRA+ CL CG DH + CP G PG+ Sbjct: 289 MICHFCSKPGHLMKDCRRANVLCLACGVADHQITTCPSRGATGGFPGR 336 >gb|KND56555.1| hypothetical protein BVER_03567 [Candidatus Burkholderia verschuerenii] Length = 350 Score = 57.4 bits (137), Expect = 1e-06 Identities = 19/37 (51%), Positives = 27/37 (72%) Frame = -3 Query: 484 IICSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 ++C YC++PGHV +C R S CLRCG+ DH + +CP Sbjct: 39 VVCRYCNKPGHVEADCWRKSNKCLRCGSADHRILKCP 75 >dbj|GAV79913.1| zf-CCHC domain-containing protein [Cephalotus follicularis] Length = 123 Score = 54.7 bits (130), Expect = 1e-06 Identities = 20/35 (57%), Positives = 25/35 (71%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 C +C R GH+ + CRR +G CLRCGAP H+V CP Sbjct: 38 CYHCGRKGHLHKVCRRMNGLCLRCGAPGHSVKDCP 72 >ref|XP_010666861.1| PREDICTED: cellular nucleic acid-binding protein homolog [Beta vulgaris subsp. vulgaris] Length = 117 Score = 54.3 bits (129), Expect = 2e-06 Identities = 21/42 (50%), Positives = 25/42 (59%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCPIPRQGAG 353 C+ C R GH+ ECRR S C RCG P H + CPIP +G Sbjct: 38 CNTCGRQGHMTNECRRGSDQCYRCGKPGHLIRNCPIPDWRSG 79 >dbj|GAV75697.1| zf-CCHC domain-containing protein/RVP_2 domain-containing protein [Cephalotus follicularis] Length = 347 Score = 56.2 bits (134), Expect = 3e-06 Identities = 21/35 (60%), Positives = 26/35 (74%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 C YC R GH ++EC R++G CLRCGAP H+V CP Sbjct: 52 CYYCGRTGHQQKECWRSNGRCLRCGAPGHSVKDCP 86 >dbj|GAV73004.1| zf-CCHC domain-containing protein/zf-CCHC_4 domain-containing protein, partial [Cephalotus follicularis] Length = 100 Score = 53.1 bits (126), Expect = 3e-06 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 C +C R GH++++C + +G CLRCG PDH V CP Sbjct: 50 CYHCGRKGHLQKDCWKKNGLCLRCGTPDHAVKDCP 84 >dbj|GAV92888.1| zf-CCHC domain-containing protein/zf-CCHC_4 domain-containing protein [Cephalotus follicularis] Length = 118 Score = 53.5 bits (127), Expect = 4e-06 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 C +C R GH++++C R +G CLRCG P HTV CP Sbjct: 38 CYHCGRKGHLQKDCWRMNGLCLRCGTPGHTVKDCP 72 >dbj|GAV91168.1| zf-CCHC domain-containing protein/zf-CCHC_4 domain-containing protein, partial [Cephalotus follicularis] Length = 104 Score = 53.1 bits (126), Expect = 4e-06 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 C +C R GH++++C R +G CLRCGAP H+V CP Sbjct: 59 CYHCGRRGHLQKDCWRMNGLCLRCGAPGHSVKDCP 93 >dbj|GAV91557.1| zf-CCHC domain-containing protein [Cephalotus follicularis] Length = 123 Score = 53.5 bits (127), Expect = 4e-06 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 C +C R GH++++C R +G CLRCGAP H+V CP Sbjct: 38 CYHCGRKGHLQKDCWRLNGLCLRCGAPGHSVKDCP 72 >dbj|GAV79570.1| zf-CCHC domain-containing protein [Cephalotus follicularis] Length = 128 Score = 53.5 bits (127), Expect = 4e-06 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 C +C R GH++++C + +G CLRCG PDH V CP Sbjct: 38 CYHCDRKGHLQKDCWKKNGLCLRCGTPDHAVKDCP 72 >ref|XP_010674863.1| PREDICTED: cold shock protein 1-like [Beta vulgaris subsp. vulgaris] Length = 169 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/42 (50%), Positives = 25/42 (59%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCPIPRQGAG 353 C+ C R GH+ ECRR S C RCG P H + CPIP +G Sbjct: 82 CNKCGRQGHMTNECRRGSDQCYRCGKPGHMIKNCPIPDWRSG 123 >dbj|GAV83813.1| zf-CCHC domain-containing protein [Cephalotus follicularis] Length = 120 Score = 53.1 bits (126), Expect = 5e-06 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 C +C R GH++++C + +G CLRCG PDH V CP Sbjct: 30 CYHCGRKGHLQKDCWKKNGLCLRCGTPDHAVKDCP 64 >dbj|GAV63112.1| zf-CCHC domain-containing protein [Cephalotus follicularis] Length = 123 Score = 53.1 bits (126), Expect = 6e-06 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 C +C R GH++++C + +G CLRCG PDH V CP Sbjct: 38 CYHCGRKGHLQKDCWKKNGLCLRCGTPDHAVKDCP 72 >dbj|GAV68742.1| zf-CCHC domain-containing protein [Cephalotus follicularis] Length = 145 Score = 53.5 bits (127), Expect = 6e-06 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 C +C R GH++++C R +G CLRCGAP H+V CP Sbjct: 64 CYHCGRKGHLQKDCWRMNGLCLRCGAPGHSVKDCP 98 >dbj|GAV70738.1| zf-CCHC domain-containing protein/zf-CCHC_4 domain-containing protein [Cephalotus follicularis] Length = 128 Score = 53.1 bits (126), Expect = 6e-06 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = -3 Query: 478 CSYCHRPGHVRRECRRASGACLRCGAPDHTVAQCP 374 C +C R GH++++C + +G CLRCG PDH V CP Sbjct: 76 CYHCGRKGHLQKDCWKKNGLCLRCGTPDHAVKDCP 110