BLASTX nr result
ID: Ophiopogon26_contig00023664
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00023664 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267727.1| auxin-responsive protein IAA33 [Asparagus of... 59 2e-08 >ref|XP_020267727.1| auxin-responsive protein IAA33 [Asparagus officinalis] gb|ONK69627.1| uncharacterized protein A4U43_C05F25020 [Asparagus officinalis] Length = 163 Score = 58.9 bits (141), Expect = 2e-08 Identities = 43/84 (51%), Positives = 46/84 (54%), Gaps = 1/84 (1%) Frame = -1 Query: 251 MNTVNSHPAEALKRPRWNVDRSVLCMTGGRGAATDPPSLLAPSAATKKLLGLXXXXXXXX 72 MNT+NSH ALKR R D S L MT + PP P TKKLLGL Sbjct: 1 MNTINSHQ-HALKRQRLTSDNSPLYMT----SLIQPP----PHPTTKKLLGLSMPVDADV 51 Query: 71 XXA-IVPPVTVVLEGRSICQRIHL 3 + IVP VTVVLEGRSIC RI L Sbjct: 52 AASAIVPSVTVVLEGRSICHRIQL 75