BLASTX nr result
ID: Ophiopogon26_contig00023627
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00023627 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247458.1| histone H1oo-like [Asparagus officinalis] 75 9e-13 >ref|XP_020247458.1| histone H1oo-like [Asparagus officinalis] Length = 442 Score = 75.5 bits (184), Expect = 9e-13 Identities = 45/97 (46%), Positives = 55/97 (56%) Frame = +1 Query: 142 NDLNSGNEKKPGRPRKILAQEGVGPPSEKRKPGRPRKNLSTVKLILPGHMMAIXXXXXXX 321 N++ SG KK GRPRK AQEG+G SEKRKPGRPRK LST +L+LP M Sbjct: 97 NNVTSG-PKKRGRPRKFPAQEGIGSQSEKRKPGRPRKKLSTTELLLPRTMK--------- 146 Query: 322 XXXXXETTSVNPESTIAMLMGEKRRPGRPKKGSLPIK 432 +M+M KR+ GRP+KGS P+K Sbjct: 147 ----------------SMVMVGKRKRGRPRKGSSPVK 167