BLASTX nr result
ID: Ophiopogon26_contig00023588
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00023588 (617 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK75855.1| uncharacterized protein A4U43_C03F21260 [Asparagu... 57 6e-06 ref|XP_020258721.1| formin-like protein 20 [Asparagus officinalis] 57 7e-06 >gb|ONK75855.1| uncharacterized protein A4U43_C03F21260 [Asparagus officinalis] Length = 1461 Score = 57.0 bits (136), Expect = 6e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +3 Query: 507 VMIRVMFNTTFVQSNSLLLDHEDIDALWKTRDQFAEH 617 +M RVMFNT FV+SN +LLDH+ +D LWKT+D F E+ Sbjct: 259 IMFRVMFNTAFVESNVMLLDHKAVDVLWKTKDHFVEN 295 >ref|XP_020258721.1| formin-like protein 20 [Asparagus officinalis] Length = 2135 Score = 57.0 bits (136), Expect = 7e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +3 Query: 507 VMIRVMFNTTFVQSNSLLLDHEDIDALWKTRDQFAEH 617 +M RVMFNT FV+SN +LLDH+ +D LWKT+D F E+ Sbjct: 327 IMFRVMFNTAFVESNVMLLDHKAVDVLWKTKDHFVEN 363