BLASTX nr result
ID: Ophiopogon26_contig00022979
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00022979 (632 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252465.1| uncharacterized protein At2g39795, mitochond... 74 3e-12 ref|XP_020244610.1| uncharacterized protein At2g39795, mitochond... 59 8e-07 >ref|XP_020252465.1| uncharacterized protein At2g39795, mitochondrial-like [Asparagus officinalis] gb|ONK76888.1| uncharacterized protein A4U43_C02F890 [Asparagus officinalis] Length = 265 Score = 73.9 bits (180), Expect = 3e-12 Identities = 42/75 (56%), Positives = 49/75 (65%) Frame = +2 Query: 407 RSIGQAHLNHCPATSLLRRGATDSLFFPKAAIGSRSDLGFFSPQRSNFSTLVAKPASDAE 586 RS+G+ L LL+R AIGSR+DLGF PQRS FS+L K ASD+E Sbjct: 20 RSLGRTLLRQTSDGRLLQR-----------AIGSRTDLGFSFPQRSQFSSLALKAASDSE 68 Query: 587 LVKVIESEIQCAEEC 631 LVKV+ESEIQCAEEC Sbjct: 69 LVKVVESEIQCAEEC 83 >ref|XP_020244610.1| uncharacterized protein At2g39795, mitochondrial-like, partial [Asparagus officinalis] Length = 235 Score = 58.5 bits (140), Expect = 8e-07 Identities = 34/59 (57%), Positives = 44/59 (74%) Frame = +2 Query: 455 LRRGATDSLFFPKAAIGSRSDLGFFSPQRSNFSTLVAKPASDAELVKVIESEIQCAEEC 631 LRR F + A+G+R D+GF SPQRS+FS++ ASD+ELVKVIESEI+CA+EC Sbjct: 1 LRRCRPTEGFSLQRAVGARIDVGF-SPQRSHFSSV----ASDSELVKVIESEIKCAKEC 54