BLASTX nr result
ID: Ophiopogon26_contig00022733
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00022733 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK67576.1| uncharacterized protein A4U43_C05F1470 [Asparagus... 64 9e-09 ref|XP_020263973.1| uncharacterized protein LOC109839921 [Aspara... 63 2e-08 gb|PKA56669.1| Rhodanese-like domain-containing protein 6 [Apost... 60 3e-07 ref|XP_020085903.1| cell division cycle and apoptosis regulator ... 59 4e-07 ref|XP_020085900.1| cell division cycle and apoptosis regulator ... 59 4e-07 ref|XP_009383928.1| PREDICTED: uncharacterized protein LOC103971... 59 7e-07 ref|XP_009383927.1| PREDICTED: uncharacterized protein LOC103971... 59 7e-07 ref|XP_003563745.1| PREDICTED: cell division cycle and apoptosis... 58 9e-07 ref|XP_020701489.1| cell division cycle and apoptosis regulator ... 58 9e-07 ref|XP_010227596.1| PREDICTED: cell division cycle and apoptosis... 58 9e-07 ref|XP_020589351.1| cell division cycle and apoptosis regulator ... 58 9e-07 ref|XP_020701487.1| cell division cycle and apoptosis regulator ... 58 9e-07 gb|PKU70922.1| hypothetical protein MA16_Dca021041 [Dendrobium c... 58 9e-07 ref|XP_020167628.1| cell division cycle and apoptosis regulator ... 57 2e-06 ref|XP_020167627.1| cell division cycle and apoptosis regulator ... 57 2e-06 gb|KDO82989.1| hypothetical protein CISIN_1g0058841mg, partial [... 57 2e-06 ref|XP_015694156.1| PREDICTED: protein split ends [Oryza brachya... 57 2e-06 ref|XP_024040990.1| cell division cycle and apoptosis regulator ... 57 2e-06 ref|XP_006483121.1| PREDICTED: cell division cycle and apoptosis... 57 2e-06 ref|XP_004236885.1| PREDICTED: cell division cycle and apoptosis... 57 3e-06 >gb|ONK67576.1| uncharacterized protein A4U43_C05F1470 [Asparagus officinalis] Length = 1678 Score = 63.9 bits (154), Expect = 9e-09 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVI 275 QAF YF N VGY KVEDLRCLL NLGKFISH+DVKVI Sbjct: 1352 QAFRYFDLNRVGYIKVEDLRCLLHNLGKFISHRDVKVI 1389 >ref|XP_020263973.1| uncharacterized protein LOC109839921 [Asparagus officinalis] Length = 2121 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 QAF YF N VGY KVEDLRCLL NLGKFISH+DVK +V L Sbjct: 2057 QAFRYFDLNRVGYIKVEDLRCLLHNLGKFISHRDVKELVQSAL 2099 >gb|PKA56669.1| Rhodanese-like domain-containing protein 6 [Apostasia shenzhenica] Length = 1972 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVK 281 QAF +F +N VGY KVEDLRC+L NLGKF+SH+DVK Sbjct: 1333 QAFIFFDYNRVGYIKVEDLRCILRNLGKFLSHRDVK 1368 >ref|XP_020085903.1| cell division cycle and apoptosis regulator protein 1 isoform X2 [Ananas comosus] Length = 1317 Score = 59.3 bits (142), Expect = 4e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 QAF YF N VGY VEDLRC++ NLGKF+SH+DVK +V L Sbjct: 1253 QAFRYFDQNRVGYITVEDLRCIIHNLGKFLSHRDVKEMVQSAL 1295 >ref|XP_020085900.1| cell division cycle and apoptosis regulator protein 1 isoform X1 [Ananas comosus] ref|XP_020085901.1| cell division cycle and apoptosis regulator protein 1 isoform X1 [Ananas comosus] ref|XP_020085902.1| cell division cycle and apoptosis regulator protein 1 isoform X1 [Ananas comosus] Length = 1321 Score = 59.3 bits (142), Expect = 4e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 QAF YF N VGY VEDLRC++ NLGKF+SH+DVK +V L Sbjct: 1257 QAFRYFDQNRVGYITVEDLRCIIHNLGKFLSHRDVKEMVQSAL 1299 >ref|XP_009383928.1| PREDICTED: uncharacterized protein LOC103971595 isoform X2 [Musa acuminata subsp. malaccensis] Length = 1406 Score = 58.5 bits (140), Expect = 7e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 QAF +F N VGY KV+DLRC+L NLGKF+SH+DVK + L Sbjct: 1340 QAFRFFDQNRVGYIKVQDLRCILHNLGKFLSHRDVKELAQSAL 1382 >ref|XP_009383927.1| PREDICTED: uncharacterized protein LOC103971595 isoform X1 [Musa acuminata subsp. malaccensis] Length = 1438 Score = 58.5 bits (140), Expect = 7e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 QAF +F N VGY KV+DLRC+L NLGKF+SH+DVK + L Sbjct: 1372 QAFRFFDQNRVGYIKVQDLRCILHNLGKFLSHRDVKELAQSAL 1414 >ref|XP_003563745.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 isoform X2 [Brachypodium distachyon] gb|KQK17961.1| hypothetical protein BRADI_1g37780v3 [Brachypodium distachyon] Length = 1347 Score = 58.2 bits (139), Expect = 9e-07 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 3/60 (5%) Frame = -1 Query: 442 KSSKVQSGFSALFLLFCK---QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIV 272 K+S Q G +A + K QAF YF N VGY KV+DLRC+L NLGKF+S++DVK +V Sbjct: 1262 KTSASQKGDAAKHEVVDKDLLQAFRYFDQNRVGYIKVDDLRCILHNLGKFLSNRDVKDMV 1321 >ref|XP_020701489.1| cell division cycle and apoptosis regulator protein 1 isoform X2 [Dendrobium catenatum] Length = 1372 Score = 58.2 bits (139), Expect = 9e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 QAF +F +N VGY K++DLRCLL +LGKF+SH+DVK +V L Sbjct: 1308 QAFRFFDYNKVGYIKMDDLRCLLHDLGKFLSHRDVKELVQSAL 1350 >ref|XP_010227596.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 isoform X1 [Brachypodium distachyon] gb|KQK17960.1| hypothetical protein BRADI_1g37780v3 [Brachypodium distachyon] Length = 1375 Score = 58.2 bits (139), Expect = 9e-07 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 3/60 (5%) Frame = -1 Query: 442 KSSKVQSGFSALFLLFCK---QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIV 272 K+S Q G +A + K QAF YF N VGY KV+DLRC+L NLGKF+S++DVK +V Sbjct: 1290 KTSASQKGDAAKHEVVDKDLLQAFRYFDQNRVGYIKVDDLRCILHNLGKFLSNRDVKDMV 1349 >ref|XP_020589351.1| cell division cycle and apoptosis regulator protein 1-like [Phalaenopsis equestris] Length = 1432 Score = 58.2 bits (139), Expect = 9e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 QAF +F +N VGY K++DLRCLL +LGKF+SH+DVK +V L Sbjct: 1368 QAFRFFDYNKVGYIKMDDLRCLLHDLGKFLSHRDVKELVQSAL 1410 >ref|XP_020701487.1| cell division cycle and apoptosis regulator protein 1 isoform X1 [Dendrobium catenatum] ref|XP_020701488.1| cell division cycle and apoptosis regulator protein 1 isoform X1 [Dendrobium catenatum] Length = 1440 Score = 58.2 bits (139), Expect = 9e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 QAF +F +N VGY K++DLRCLL +LGKF+SH+DVK +V L Sbjct: 1376 QAFRFFDYNKVGYIKMDDLRCLLHDLGKFLSHRDVKELVQSAL 1418 >gb|PKU70922.1| hypothetical protein MA16_Dca021041 [Dendrobium catenatum] Length = 1453 Score = 58.2 bits (139), Expect = 9e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 QAF +F +N VGY K++DLRCLL +LGKF+SH+DVK +V L Sbjct: 1389 QAFRFFDYNKVGYIKMDDLRCLLHDLGKFLSHRDVKELVQSAL 1431 >ref|XP_020167628.1| cell division cycle and apoptosis regulator protein 1-like isoform X2 [Aegilops tauschii subsp. tauschii] Length = 1394 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIV 272 QAF YF N VGY KV+DLRC+L NLGKF+S++DVK +V Sbjct: 1330 QAFRYFDQNRVGYIKVDDLRCILHNLGKFLSNRDVKDMV 1368 >ref|XP_020167627.1| cell division cycle and apoptosis regulator protein 1-like isoform X1 [Aegilops tauschii subsp. tauschii] Length = 1422 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 388 QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIV 272 QAF YF N VGY KV+DLRC+L NLGKF+S++DVK +V Sbjct: 1358 QAFRYFDQNRVGYIKVDDLRCILHNLGKFLSNRDVKDMV 1396 >gb|KDO82989.1| hypothetical protein CISIN_1g0058841mg, partial [Citrus sinensis] Length = 535 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = -1 Query: 430 VQSGFSALFLLFCKQAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 V++G +F QAF +F N VGY +VEDLR ++ NLGKF+SH+DVK +V L Sbjct: 457 VETGKKEVFDKELLQAFRFFDRNQVGYIRVEDLRLIIHNLGKFLSHRDVKELVQSAL 513 >ref|XP_015694156.1| PREDICTED: protein split ends [Oryza brachyantha] Length = 1365 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/60 (51%), Positives = 41/60 (68%), Gaps = 3/60 (5%) Frame = -1 Query: 442 KSSKVQSGFSALFLLFCK---QAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIV 272 K+++ Q G SA + K QAF YF N GY KV+DLRC+L NLGKF+S++DVK +V Sbjct: 1280 KTTRSQKGDSAKDEVVDKELLQAFRYFDQNKAGYLKVDDLRCILHNLGKFLSNRDVKDLV 1339 >ref|XP_024040990.1| cell division cycle and apoptosis regulator protein 1 isoform X1 [Citrus clementina] Length = 1401 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = -1 Query: 430 VQSGFSALFLLFCKQAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 V++G +F QAF +F N VGY +VEDLR ++ NLGKF+SH+DVK +V L Sbjct: 1323 VETGKKEVFDKELLQAFRFFDRNQVGYIRVEDLRLIIHNLGKFLSHRDVKELVQSAL 1379 >ref|XP_006483121.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 [Citrus sinensis] Length = 1401 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = -1 Query: 430 VQSGFSALFLLFCKQAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 V++G +F QAF +F N VGY +VEDLR ++ NLGKF+SH+DVK +V L Sbjct: 1323 VETGKKEVFDKELLQAFRFFDRNQVGYIRVEDLRLIIHNLGKFLSHRDVKELVQSAL 1379 >ref|XP_004236885.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 [Solanum lycopersicum] Length = 1363 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/60 (46%), Positives = 37/60 (61%) Frame = -1 Query: 439 SSKVQSGFSALFLLFCKQAF*YFTHNHVGYTKVEDLRCLLPNLGKFISHKDVKVIVVKCL 260 S+KV+ F QAF +F N GY +VED+R +L NLGKF+SH+DVK +V L Sbjct: 1283 STKVEKNTKTEFNKELLQAFRFFDRNRAGYVRVEDMRLILHNLGKFLSHRDVKELVQSAL 1342