BLASTX nr result
ID: Ophiopogon26_contig00021989
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00021989 (468 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252251.1| uncharacterized protein LOC109829598 [Aspara... 57 1e-06 >ref|XP_020252251.1| uncharacterized protein LOC109829598 [Asparagus officinalis] Length = 343 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/45 (53%), Positives = 29/45 (64%) Frame = -1 Query: 357 LCFRCGDKSHLAMDCRNAVRCRRCQKLGHTFRNCRVWQWEHGLFN 223 LCFRCG H+A DCR+ + C RCQ++GH RNCR HG N Sbjct: 125 LCFRCGGSKHMAKDCRDPIVCFRCQEVGHEARNCRSGVPGHGSDN 169