BLASTX nr result
ID: Ophiopogon26_contig00021849
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00021849 (825 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS20977.1| protease inhibitor/seed storage/lipid transfer pr... 123 6e-32 gb|PKI52564.1| hypothetical protein CRG98_027036 [Punica granatum] 113 4e-28 gb|PHT52330.1| Repetitive proline-rich cell wall protein [Capsic... 115 2e-27 ref|XP_016540193.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 115 2e-27 gb|PHU08294.1| Repetitive proline-rich cell wall protein 2 [Caps... 115 3e-27 ref|XP_021970662.1| 36.4 kDa proline-rich protein-like [Helianth... 115 3e-27 gb|KZV14087.1| hypothetical protein F511_44457 [Dorcoceras hygro... 114 3e-27 gb|PKU66560.1| 36.4 kDa proline-rich protein [Dendrobium catenatum] 114 4e-27 ref|XP_023529211.1| 36.4 kDa proline-rich protein-like [Cucurbit... 113 6e-27 ref|XP_022966511.1| 36.4 kDa proline-rich protein-like [Cucurbit... 113 6e-27 ref|XP_022933855.1| 36.4 kDa proline-rich protein-like [Cucurbit... 113 6e-27 ref|XP_011078375.1| 36.4 kDa proline-rich protein-like [Sesamum ... 113 8e-27 gb|AAT42190.1| putative proline-rich protein, partial [Nicotiana... 112 8e-27 emb|CDP10452.1| unnamed protein product [Coffea canephora] 113 1e-26 ref|XP_022144829.1| 36.4 kDa proline-rich protein [Momordica cha... 112 1e-26 ref|XP_019183904.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 113 1e-26 ref|XP_012828579.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 114 2e-26 ref|XP_010533129.1| PREDICTED: pEARLI1-like lipid transfer prote... 113 2e-26 ref|XP_020699302.1| 36.4 kDa proline-rich protein-like [Dendrobi... 114 2e-26 ref|XP_019183903.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 113 2e-26 >gb|AAS20977.1| protease inhibitor/seed storage/lipid transfer protein, partial [Hyacinthus orientalis] Length = 113 Score = 123 bits (309), Expect = 6e-32 Identities = 54/76 (71%), Positives = 63/76 (82%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIGDPAVECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLPVAL 293 NTLKLG CL +LG +H GDPAV+CCPLIAGL+SV AAACLCT IKL A G+ L++P+A+ Sbjct: 37 NTLKLGTCLDVLGGIIHAGDPAVDCCPLIAGLTSVQAAACLCTAIKLKAGGVNLYVPIAV 96 Query: 292 ELLVICGKTPPPGYTC 245 ELLV CGK PPPGY C Sbjct: 97 ELLVTCGKKPPPGYKC 112 >gb|PKI52564.1| hypothetical protein CRG98_027036 [Punica granatum] Length = 115 Score = 113 bits (283), Expect = 4e-28 Identities = 52/80 (65%), Positives = 66/80 (82%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VHIG DPAV ECCP++AGL + AA CLCTT+KL L +K+++P Sbjct: 35 DTLKLGACVDLLGGLVHIGVGDPAVNECCPVLAGLVELEAAVCLCTTLKLKVLNLKIYVP 94 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LLV CGKTPPPGYTC+ Sbjct: 95 LALQLLVTCGKTPPPGYTCS 114 >gb|PHT52330.1| Repetitive proline-rich cell wall protein [Capsicum baccatum] Length = 249 Score = 115 bits (289), Expect = 2e-27 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VHIG DPAV ECCP+I+GL+ + AAACLCTT+KL L +K+++P Sbjct: 169 DTLKLGACVDLLGGLVHIGLGDPAVHECCPIISGLAELEAAACLCTTLKLKLLNLKIYVP 228 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LLV CGKTPPPGYTC+ Sbjct: 229 LALQLLVTCGKTPPPGYTCS 248 >ref|XP_016540193.1| PREDICTED: 36.4 kDa proline-rich protein-like [Capsicum annuum] gb|PHT73769.1| Repetitive proline-rich cell wall protein 2 [Capsicum annuum] Length = 249 Score = 115 bits (289), Expect = 2e-27 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VHIG DPAV ECCP+I+GL+ + AAACLCTT+KL L +K+++P Sbjct: 169 DTLKLGACVDLLGGLVHIGLGDPAVHECCPIISGLAELEAAACLCTTLKLKLLNLKIYVP 228 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LLV CGKTPPPGYTC+ Sbjct: 229 LALQLLVTCGKTPPPGYTCS 248 >gb|PHU08294.1| Repetitive proline-rich cell wall protein 2 [Capsicum chinense] Length = 259 Score = 115 bits (289), Expect = 3e-27 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VHIG DPAV ECCP+I+GL+ + AAACLCTT+KL L +K+++P Sbjct: 179 DTLKLGACVDLLGGLVHIGLGDPAVHECCPIISGLAELEAAACLCTTLKLKLLNLKIYVP 238 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LLV CGKTPPPGYTC+ Sbjct: 239 LALQLLVTCGKTPPPGYTCS 258 >ref|XP_021970662.1| 36.4 kDa proline-rich protein-like [Helianthus annuus] gb|OTG23280.1| putative bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Helianthus annuus] Length = 261 Score = 115 bits (289), Expect = 3e-27 Identities = 53/80 (66%), Positives = 67/80 (83%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VHIG DPAV +CCP+IAGL+ + AA CLCTT+KL AL + +++P Sbjct: 181 DTLKLGACVDLLGGLVHIGLGDPAVNKCCPIIAGLAELEAAVCLCTTLKLKALNLNIYVP 240 Query: 301 VALELLVICGKTPPPGYTCA 242 +ALELLV CGKTPPPGYTC+ Sbjct: 241 IALELLVTCGKTPPPGYTCS 260 >gb|KZV14087.1| hypothetical protein F511_44457 [Dorcoceras hygrometricum] gb|KZV14235.1| hypothetical protein F511_44104 [Dorcoceras hygrometricum] Length = 192 Score = 114 bits (284), Expect = 3e-27 Identities = 51/79 (64%), Positives = 66/79 (83%), Gaps = 3/79 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHI--GDPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VH+ GDPAV ECCP+++GL + AAACLCTTIKL AL + +++P Sbjct: 112 DTLKLGACVDLLGGLVHVVLGDPAVHECCPVLSGLLELEAAACLCTTIKLKALNLNIYIP 171 Query: 301 VALELLVICGKTPPPGYTC 245 +AL++L ICGKTPPPGYTC Sbjct: 172 IALQVLAICGKTPPPGYTC 190 >gb|PKU66560.1| 36.4 kDa proline-rich protein [Dendrobium catenatum] Length = 224 Score = 114 bits (285), Expect = 4e-27 Identities = 53/78 (67%), Positives = 61/78 (78%), Gaps = 1/78 (1%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIGDPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLPVA 296 +TLKLG CL IL + IGDPAV ECCP+I GL+ + AAACLCTTIKL L I++ P+A Sbjct: 147 DTLKLGTCLDILSNVIQIGDPAVNECCPVIKGLTGIEAAACLCTTIKLKLLNIRVLFPIA 206 Query: 295 LELLVICGKTPPPGYTCA 242 ELLV CGKTPPPGYTCA Sbjct: 207 FELLVSCGKTPPPGYTCA 224 >ref|XP_023529211.1| 36.4 kDa proline-rich protein-like [Cucurbita pepo subsp. pepo] Length = 206 Score = 113 bits (283), Expect = 6e-27 Identities = 50/80 (62%), Positives = 67/80 (83%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VHIG DPAV ECCP+++GL+ V AA CLCTT+K+ AL + +++P Sbjct: 126 DTLKLGACVDLLGGLVHIGLGDPAVNECCPVLSGLAEVEAAVCLCTTLKIKALSLNIYVP 185 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LL+ CGKTPPPGYTC+ Sbjct: 186 IALQLLISCGKTPPPGYTCS 205 >ref|XP_022966511.1| 36.4 kDa proline-rich protein-like [Cucurbita maxima] Length = 206 Score = 113 bits (283), Expect = 6e-27 Identities = 50/80 (62%), Positives = 67/80 (83%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VHIG DPAV ECCP+++GL+ V AA CLCTT+K+ AL + +++P Sbjct: 126 DTLKLGACVDLLGGLVHIGLGDPAVNECCPVLSGLAEVEAAVCLCTTLKIKALSLNIYVP 185 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LL+ CGKTPPPGYTC+ Sbjct: 186 IALQLLISCGKTPPPGYTCS 205 >ref|XP_022933855.1| 36.4 kDa proline-rich protein-like [Cucurbita moschata] Length = 206 Score = 113 bits (283), Expect = 6e-27 Identities = 50/80 (62%), Positives = 67/80 (83%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VHIG DPAV ECCP+++GL+ V AA CLCTT+K+ AL + +++P Sbjct: 126 DTLKLGACVDLLGGLVHIGLGDPAVNECCPVLSGLAEVEAAVCLCTTLKIKALSLNIYVP 185 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LL+ CGKTPPPGYTC+ Sbjct: 186 IALQLLISCGKTPPPGYTCS 205 >ref|XP_011078375.1| 36.4 kDa proline-rich protein-like [Sesamum indicum] Length = 208 Score = 113 bits (282), Expect = 8e-27 Identities = 51/80 (63%), Positives = 67/80 (83%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VHIG DPAV ECCP+++GL + AAACLCTT+K+ AL + +++P Sbjct: 128 DTLKLGACVDLLGGLVHIGLGDPAVNECCPMLSGLVELEAAACLCTTLKIKALNLNIYVP 187 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LLV CGKTPPPGYTC+ Sbjct: 188 LALQLLVTCGKTPPPGYTCS 207 >gb|AAT42190.1| putative proline-rich protein, partial [Nicotiana tabacum] Length = 195 Score = 112 bits (281), Expect = 8e-27 Identities = 52/80 (65%), Positives = 66/80 (82%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VHIG DPAV ECCP++ GL + AAACLCTT+K+ L +K+F+P Sbjct: 115 DTLKLGACVDLLGGLVHIGIGDPAVNECCPILHGLVELEAAACLCTTLKVKLLNLKIFVP 174 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LLV CGKTPPPGYTC+ Sbjct: 175 LALQLLVTCGKTPPPGYTCS 194 >emb|CDP10452.1| unnamed protein product [Coffea canephora] Length = 237 Score = 113 bits (283), Expect = 1e-26 Identities = 51/80 (63%), Positives = 65/80 (81%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLK+GAC +LG +HIG DP V ECCP+++GL V AA CLCTT+KL AL +++F+P Sbjct: 157 DTLKMGACADVLGGVMHIGFGDPVVNECCPILSGLVDVEAAVCLCTTLKLKALNLEMFVP 216 Query: 301 VALELLVICGKTPPPGYTCA 242 +ALELLV CGKTPPPGYTC+ Sbjct: 217 IALELLVYCGKTPPPGYTCS 236 >ref|XP_022144829.1| 36.4 kDa proline-rich protein [Momordica charantia] Length = 210 Score = 112 bits (281), Expect = 1e-26 Identities = 50/80 (62%), Positives = 65/80 (81%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLG C+ +LG VHIG DPA ECCP++AGL+ V AA CLCTT+K+ AL + L++P Sbjct: 130 DTLKLGGCVDLLGGLVHIGLGDPAANECCPVLAGLAEVEAAVCLCTTLKIKALNLNLYVP 189 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LL+ CGKTPPPGYTC+ Sbjct: 190 IALQLLITCGKTPPPGYTCS 209 >ref|XP_019183904.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X2 [Ipomoea nil] Length = 232 Score = 113 bits (282), Expect = 1e-26 Identities = 51/80 (63%), Positives = 66/80 (82%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VH+G DPAV ECCP++ GL + AAACLCTT+K+ AL + +++P Sbjct: 152 DTLKLGACVDLLGGLVHVGLGDPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP 211 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LLV CGKTPPPGYTCA Sbjct: 212 LALQLLVTCGKTPPPGYTCA 231 >ref|XP_012828579.1| PREDICTED: 36.4 kDa proline-rich protein-like [Erythranthe guttata] gb|EYU18244.1| hypothetical protein MIMGU_mgv1a011967mg [Erythranthe guttata] Length = 265 Score = 114 bits (284), Expect = 2e-26 Identities = 53/80 (66%), Positives = 66/80 (82%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VHIG DPAV ECCP+I+GL AAACLCTT+K+ AL +KL++P Sbjct: 185 DTLKLGACVDLLGGLVHIGLGDPAVNECCPIISGLVEAEAAACLCTTLKVKALNLKLYVP 244 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LLV CGKTPPPGY C+ Sbjct: 245 IALQLLVSCGKTPPPGYECS 264 >ref|XP_010533129.1| PREDICTED: pEARLI1-like lipid transfer protein 3 [Tarenaya hassleriana] Length = 251 Score = 113 bits (283), Expect = 2e-26 Identities = 54/80 (67%), Positives = 67/80 (83%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG V IG DPAV +CCPL+ GL+ V AAACLCTT+KL AL +KL++P Sbjct: 171 DTLKLGACVDLLGGLVKIGLGDPAVNKCCPLVKGLAEVEAAACLCTTLKLKALNLKLYVP 230 Query: 301 VALELLVICGKTPPPGYTCA 242 VAL+LLV CGKTPPPG+TC+ Sbjct: 231 VALQLLVSCGKTPPPGFTCS 250 >ref|XP_020699302.1| 36.4 kDa proline-rich protein-like [Dendrobium catenatum] Length = 290 Score = 114 bits (285), Expect = 2e-26 Identities = 53/78 (67%), Positives = 61/78 (78%), Gaps = 1/78 (1%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIGDPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLPVA 296 +TLKLG CL IL + IGDPAV ECCP+I GL+ + AAACLCTTIKL L I++ P+A Sbjct: 213 DTLKLGTCLDILSNVIQIGDPAVNECCPVIKGLTGIEAAACLCTTIKLKLLNIRVLFPIA 272 Query: 295 LELLVICGKTPPPGYTCA 242 ELLV CGKTPPPGYTCA Sbjct: 273 FELLVSCGKTPPPGYTCA 290 >ref|XP_019183903.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X1 [Ipomoea nil] Length = 248 Score = 113 bits (282), Expect = 2e-26 Identities = 51/80 (63%), Positives = 66/80 (82%), Gaps = 3/80 (3%) Frame = -3 Query: 472 NTLKLGACLQILGAPVHIG--DPAV-ECCPLIAGLSSVSAAACLCTTIKLNALGIKLFLP 302 +TLKLGAC+ +LG VH+G DPAV ECCP++ GL + AAACLCTT+K+ AL + +++P Sbjct: 168 DTLKLGACVDLLGGLVHVGLGDPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP 227 Query: 301 VALELLVICGKTPPPGYTCA 242 +AL+LLV CGKTPPPGYTCA Sbjct: 228 LALQLLVTCGKTPPPGYTCA 247