BLASTX nr result
ID: Ophiopogon26_contig00021441
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00021441 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273977.1| polyadenylate-binding protein-interacting pr... 66 4e-10 ref|XP_020575197.1| polyadenylate-binding protein-interacting pr... 59 3e-07 ref|XP_020672493.1| polyadenylate-binding protein-interacting pr... 58 5e-07 ref|XP_009407874.2| PREDICTED: polyadenylate-binding protein-int... 56 2e-06 ref|XP_024010126.1| polyadenylate-binding protein-interacting pr... 55 3e-06 ref|XP_019578491.1| PREDICTED: polyadenylate-binding protein-int... 55 3e-06 ref|XP_006397030.1| polyadenylate-binding protein-interacting pr... 55 3e-06 ref|XP_004502742.1| PREDICTED: polyadenylate-binding protein-int... 55 3e-06 gb|PNY07829.1| polyadenylate-binding protein [Trifolium pratense] 55 3e-06 ref|XP_008462907.1| PREDICTED: polyadenylate-binding protein-int... 55 3e-06 ref|XP_004137206.1| PREDICTED: polyadenylate-binding protein-int... 55 3e-06 ref|XP_023637256.1| polyadenylate-binding protein-interacting pr... 55 6e-06 gb|EOA20843.1| hypothetical protein CARUB_v10001178mg [Capsella ... 55 6e-06 ref|XP_022984928.1| polyadenylate-binding protein-interacting pr... 55 6e-06 ref|XP_022922600.1| polyadenylate-binding protein-interacting pr... 55 6e-06 ref|XP_023552522.1| polyadenylate-binding protein-interacting pr... 55 6e-06 ref|XP_016457789.1| PREDICTED: polyadenylate-binding protein-int... 54 7e-06 dbj|GAU43664.1| hypothetical protein TSUD_302270 [Trifolium subt... 54 7e-06 ref|XP_009791784.1| PREDICTED: polyadenylate-binding protein-int... 54 7e-06 ref|XP_016457788.1| PREDICTED: polyadenylate-binding protein-int... 54 8e-06 >ref|XP_020273977.1| polyadenylate-binding protein-interacting protein 11-like [Asparagus officinalis] gb|ONK64344.1| uncharacterized protein A4U43_C07F24720 [Asparagus officinalis] Length = 275 Score = 65.9 bits (159), Expect = 4e-10 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 2/50 (4%) Frame = +3 Query: 264 IRDLEELLSKLNPMAEEFVPPSLNVDARSYFDGFYYG--NEGGIAGIYSN 407 +RDLEELLSKLNPMAEEFVPPSLN + SY +GF++G N GI G+Y+N Sbjct: 1 MRDLEELLSKLNPMAEEFVPPSLN-SSGSYSEGFFHGGRNGEGIPGVYAN 49 >ref|XP_020575197.1| polyadenylate-binding protein-interacting protein 12-like [Phalaenopsis equestris] Length = 374 Score = 58.5 bits (140), Expect = 3e-07 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 3/54 (5%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPS-LNVDARSYFD--GFYYGNEGGIAGIYSN 407 K+++RDLEELLSKLNPMA EFVPPS N +RS+ D G + N GI G+Y+N Sbjct: 90 KQDMRDLEELLSKLNPMAAEFVPPSHTNYASRSFGDRGGGFVSNNVGIHGLYTN 143 >ref|XP_020672493.1| polyadenylate-binding protein-interacting protein 11-like [Dendrobium catenatum] Length = 373 Score = 57.8 bits (138), Expect = 5e-07 Identities = 29/53 (54%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPS-LNVDARSYFD-GFYYGNEGGIAGIYSN 407 K+++RDLEELLSKLNPMA EFVPPS +N ++ + D G ++ N GG+ +Y N Sbjct: 90 KQDMRDLEELLSKLNPMAAEFVPPSHINHASKGFGDGGSFFSNNGGLHDLYPN 142 >ref|XP_009407874.2| PREDICTED: polyadenylate-binding protein-interacting protein 11-like [Musa acuminata subsp. malaccensis] Length = 400 Score = 56.2 bits (134), Expect = 2e-06 Identities = 30/54 (55%), Positives = 40/54 (74%), Gaps = 3/54 (5%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDGFYYGNEGGIA---GIYSN 407 K+E+RDLE+LLSKLNPMAEEFVPPS+ + ++ DG GG+A G+Y+N Sbjct: 120 KRELRDLEDLLSKLNPMAEEFVPPSIAGNIQAASDG-----AGGVAFGGGLYAN 168 >ref|XP_024010126.1| polyadenylate-binding protein-interacting protein 12 isoform X2 [Eutrema salsugineum] Length = 340 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDG 362 K+E+R+L ELLSKLNPMAEEFVPPSLN A + F+G Sbjct: 60 KREMRELHELLSKLNPMAEEFVPPSLNKQAANGFNG 95 >ref|XP_019578491.1| PREDICTED: polyadenylate-binding protein-interacting protein 12 [Rhinolophus sinicus] Length = 340 Score = 55.5 bits (132), Expect = 3e-06 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 8/57 (14%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDG--------FYYGNEGGIAGIY 401 K+++R+L+ELLSKLNPMAEEFVPPSLN + F+G F N+ G AG + Sbjct: 61 KRDMRELQELLSKLNPMAEEFVPPSLNKQGGNGFNGGFFTVAGSFLRNNDFGAAGYF 117 >ref|XP_006397030.1| polyadenylate-binding protein-interacting protein 12 isoform X1 [Eutrema salsugineum] gb|ESQ38483.1| hypothetical protein EUTSA_v10028784mg [Eutrema salsugineum] Length = 341 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDG 362 K+E+R+L ELLSKLNPMAEEFVPPSLN A + F+G Sbjct: 60 KREMRELHELLSKLNPMAEEFVPPSLNKQAANGFNG 95 >ref|XP_004502742.1| PREDICTED: polyadenylate-binding protein-interacting protein 12-like [Cicer arietinum] Length = 379 Score = 55.5 bits (132), Expect = 3e-06 Identities = 28/43 (65%), Positives = 31/43 (72%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDGFYYGNEG 383 K+E+RDLEELLSKLNPMAEEFVPPSL + Y G G G Sbjct: 104 KREMRDLEELLSKLNPMAEEFVPPSLVTNYHGYLAGPNVGGFG 146 >gb|PNY07829.1| polyadenylate-binding protein [Trifolium pratense] Length = 386 Score = 55.5 bits (132), Expect = 3e-06 Identities = 31/56 (55%), Positives = 36/56 (64%), Gaps = 5/56 (8%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYF-----DGFYYGNEGGIAGIYSN 407 K+E+RDLEELLSKLNPMAEEFVPPSL + + Y GF Y N I + N Sbjct: 111 KREMRDLEELLSKLNPMAEEFVPPSLVTNYQGYLAAGPNAGFGYPNNFMIQNNFGN 166 >ref|XP_008462907.1| PREDICTED: polyadenylate-binding protein-interacting protein 12 [Cucumis melo] Length = 403 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDG 362 K+++RDLEELLSKLNPMAEEFVPPSL + YF G Sbjct: 131 KRDMRDLEELLSKLNPMAEEFVPPSLAKNFSGYFTG 166 >ref|XP_004137206.1| PREDICTED: polyadenylate-binding protein-interacting protein 12 [Cucumis sativus] ref|XP_011653324.1| PREDICTED: polyadenylate-binding protein-interacting protein 12 [Cucumis sativus] gb|KGN53617.1| hypothetical protein Csa_4G090360 [Cucumis sativus] Length = 403 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDG 362 K+++RDLEELLSKLNPMAEEFVPPSL + YF G Sbjct: 131 KRDMRDLEELLSKLNPMAEEFVPPSLAKNFSGYFTG 166 >ref|XP_023637256.1| polyadenylate-binding protein-interacting protein 12 [Capsella rubella] Length = 341 Score = 54.7 bits (130), Expect = 6e-06 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDGFYY--GNEGGIAG 395 K+++R+L ELLSKLNPMAEEFVPPSL + F+G Y+ N G+AG Sbjct: 66 KRDMRELHELLSKLNPMAEEFVPPSLTKPVVNGFNGGYFAVNNGFGVAG 114 >gb|EOA20843.1| hypothetical protein CARUB_v10001178mg [Capsella rubella] Length = 379 Score = 54.7 bits (130), Expect = 6e-06 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDGFYY--GNEGGIAG 395 K+++R+L ELLSKLNPMAEEFVPPSL + F+G Y+ N G+AG Sbjct: 104 KRDMRELHELLSKLNPMAEEFVPPSLTKPVVNGFNGGYFAVNNGFGVAG 152 >ref|XP_022984928.1| polyadenylate-binding protein-interacting protein 12 [Cucurbita maxima] ref|XP_022984929.1| polyadenylate-binding protein-interacting protein 12 [Cucurbita maxima] Length = 402 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDGFYYG 374 K+++RDLE+LLSKLNPMAEEFVPPSL + YF G G Sbjct: 130 KRDMRDLEDLLSKLNPMAEEFVPPSLAKNFSGYFGGAALG 169 >ref|XP_022922600.1| polyadenylate-binding protein-interacting protein 12 [Cucurbita moschata] ref|XP_022922601.1| polyadenylate-binding protein-interacting protein 12 [Cucurbita moschata] Length = 402 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDGFYYG 374 K+++RDLE+LLSKLNPMAEEFVPPSL + YF G G Sbjct: 130 KRDMRDLEDLLSKLNPMAEEFVPPSLAKNFSGYFGGAALG 169 >ref|XP_023552522.1| polyadenylate-binding protein-interacting protein 12 [Cucurbita pepo subsp. pepo] ref|XP_023552523.1| polyadenylate-binding protein-interacting protein 12 [Cucurbita pepo subsp. pepo] Length = 403 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLNVDARSYFDGFYYG 374 K+++RDLE+LLSKLNPMAEEFVPPSL + YF G G Sbjct: 131 KRDMRDLEDLLSKLNPMAEEFVPPSLAKNFSGYFGGAALG 170 >ref|XP_016457789.1| PREDICTED: polyadenylate-binding protein-interacting protein 11-like isoform X2 [Nicotiana tabacum] Length = 327 Score = 54.3 bits (129), Expect = 7e-06 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 11/60 (18%) Frame = +3 Query: 249 FMKKEIRDLEELLSKLNPMAEEFVPPSLNVD-----------ARSYFDGFYYGNEGGIAG 395 F +E+RDLEE+LSKLNPMAEEFVPPSL+ + + FD F + + G+AG Sbjct: 74 FNSREMRDLEEMLSKLNPMAEEFVPPSLSTNHGGVVQFLSGGEQFGFDAFNFFMQAGLAG 133 >dbj|GAU43664.1| hypothetical protein TSUD_302270 [Trifolium subterraneum] Length = 331 Score = 54.3 bits (129), Expect = 7e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 255 KKEIRDLEELLSKLNPMAEEFVPPSLN 335 K+E+RDLEELLSKLNPMAEEFVPPSLN Sbjct: 120 KREMRDLEELLSKLNPMAEEFVPPSLN 146 >ref|XP_009791784.1| PREDICTED: polyadenylate-binding protein-interacting protein 11-like isoform X3 [Nicotiana sylvestris] ref|XP_016447011.1| PREDICTED: polyadenylate-binding protein-interacting protein 11-like isoform X3 [Nicotiana tabacum] Length = 331 Score = 54.3 bits (129), Expect = 7e-06 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 11/60 (18%) Frame = +3 Query: 249 FMKKEIRDLEELLSKLNPMAEEFVPPSLNVD-----------ARSYFDGFYYGNEGGIAG 395 F +E+RDLEE+LSKLNPMAEEFVPPSL+ + + FD F + + G+AG Sbjct: 78 FNSREMRDLEEMLSKLNPMAEEFVPPSLSTNHGGVVQFLPGGEQFGFDAFNFFMQAGLAG 137 >ref|XP_016457788.1| PREDICTED: polyadenylate-binding protein-interacting protein 11-like isoform X1 [Nicotiana tabacum] Length = 351 Score = 54.3 bits (129), Expect = 8e-06 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 11/60 (18%) Frame = +3 Query: 249 FMKKEIRDLEELLSKLNPMAEEFVPPSLNVD-----------ARSYFDGFYYGNEGGIAG 395 F +E+RDLEE+LSKLNPMAEEFVPPSL+ + + FD F + + G+AG Sbjct: 74 FNSREMRDLEEMLSKLNPMAEEFVPPSLSTNHGGVVQFLSGGEQFGFDAFNFFMQAGLAG 133