BLASTX nr result
ID: Ophiopogon26_contig00021329
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00021329 (612 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC31600.1| hypothetical protein RIR_1689700 [Rhizophagus ir... 128 7e-35 gb|EXX53645.1| hypothetical protein RirG_242180 [Rhizophagus irr... 111 2e-28 >dbj|GBC31600.1| hypothetical protein RIR_1689700 [Rhizophagus irregularis DAOM 181602] gb|PKC14827.1| hypothetical protein RhiirA5_349828 [Rhizophagus irregularis] gb|PKC68175.1| hypothetical protein RhiirA1_417165 [Rhizophagus irregularis] gb|PKK76211.1| hypothetical protein RhiirC2_734870 [Rhizophagus irregularis] gb|PKY13440.1| hypothetical protein RhiirB3_398846 [Rhizophagus irregularis] gb|PKY46008.1| hypothetical protein RhiirA4_401940 [Rhizophagus irregularis] gb|POG74763.1| hypothetical protein GLOIN_2v1771025 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 97 Score = 128 bits (321), Expect = 7e-35 Identities = 68/97 (70%), Positives = 68/97 (70%) Frame = +1 Query: 295 MGKPKRNRMQMEIDNEPTSPPKPMNIDKWSISSQERKGADNXXXXXXXXXXXXXXXXXXX 474 MGKPKRNRMQMEIDNEPTSPPKPMNIDKWSISSQERKGADN Sbjct: 1 MGKPKRNRMQMEIDNEPTSPPKPMNIDKWSISSQERKGADNLLHKIKKKPKPLRAKAKKR 60 Query: 475 XEQGIKRALNXXXXXXXXXAKSLEKLNKKKRLKSIQE 585 EQGIKRALN AKSLEKLNKKKRLKSIQE Sbjct: 61 REQGIKRALNIKEKEEIKIAKSLEKLNKKKRLKSIQE 97 >gb|EXX53645.1| hypothetical protein RirG_242180 [Rhizophagus irregularis DAOM 197198w] gb|EXX53646.1| hypothetical protein RirG_242180 [Rhizophagus irregularis DAOM 197198w] Length = 89 Score = 111 bits (277), Expect = 2e-28 Identities = 60/89 (67%), Positives = 60/89 (67%) Frame = +1 Query: 319 MQMEIDNEPTSPPKPMNIDKWSISSQERKGADNXXXXXXXXXXXXXXXXXXXXEQGIKRA 498 MQMEIDNEPTSPPKPMNIDKWSISSQERKGADN EQGIKRA Sbjct: 1 MQMEIDNEPTSPPKPMNIDKWSISSQERKGADNLLHKIKKKPKPLRAKAKKRREQGIKRA 60 Query: 499 LNXXXXXXXXXAKSLEKLNKKKRLKSIQE 585 LN AKSLEKLNKKKRLKSIQE Sbjct: 61 LNIKEKEEIKIAKSLEKLNKKKRLKSIQE 89