BLASTX nr result
ID: Ophiopogon26_contig00021245
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00021245 (808 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019464961.1| PREDICTED: methionine aminopeptidase 1A-like... 61 4e-07 gb|KDO85766.1| hypothetical protein CISIN_1g0158381mg, partial [... 59 4e-07 gb|KHG30021.1| Methionine aminopeptidase 1A -like protein [Gossy... 61 5e-07 ref|XP_020674539.1| methionine aminopeptidase 1A isoform X2 [Den... 61 5e-07 ref|NP_001325142.1| methionine aminopeptidase 1A [Arabidopsis th... 61 5e-07 ref|XP_019189181.1| PREDICTED: methionine aminopeptidase 1A isof... 61 6e-07 gb|KJB49324.1| hypothetical protein B456_008G113300 [Gossypium r... 61 6e-07 ref|XP_022641787.1| methionine aminopeptidase 1A isoform X2 [Vig... 60 1e-06 gb|ACF82432.1| unknown [Zea mays] 57 1e-06 gb|PNT03372.1| hypothetical protein POPTR_014G067300v3 [Populus ... 60 1e-06 gb|PIA50111.1| hypothetical protein AQUCO_01300686v1, partial [A... 60 1e-06 gb|ONK73808.1| uncharacterized protein A4U43_C04F35600 [Asparagu... 58 2e-06 gb|ONM05214.1| Methionine aminopeptidase 1A [Zea mays] 57 2e-06 gb|OEL30060.1| Methionine aminopeptidase 1A [Dichanthelium oligo... 59 2e-06 ref|XP_020263462.1| methionine aminopeptidase 1A, partial [Aspar... 58 2e-06 ref|XP_021802971.1| methionine aminopeptidase 1A-like [Prunus av... 55 2e-06 gb|ESR58536.1| hypothetical protein CICLE_v10020473mg [Citrus cl... 59 3e-06 ref|XP_014628947.1| PREDICTED: methionine aminopeptidase 1A-like... 58 4e-06 ref|XP_020998165.1| methionine aminopeptidase 1A-like [Arachis d... 55 5e-06 gb|KDO85764.1| hypothetical protein CISIN_1g0158381mg, partial [... 57 5e-06 >ref|XP_019464961.1| PREDICTED: methionine aminopeptidase 1A-like isoform X2 [Lupinus angustifolius] Length = 333 Score = 61.2 bits (147), Expect = 4e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSILVLV 721 VKSYCGHGIG+LFHCAPNIPHY SIL +V Sbjct: 305 VKSYCGHGIGELFHCAPNIPHYGSILFVV 333 >gb|KDO85766.1| hypothetical protein CISIN_1g0158381mg, partial [Citrus sinensis] gb|KDO85767.1| hypothetical protein CISIN_1g0158381mg, partial [Citrus sinensis] Length = 159 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSI 733 VKSYCGHGIG+LFHCAPNIPHYSS+ Sbjct: 110 VKSYCGHGIGELFHCAPNIPHYSSL 134 >gb|KHG30021.1| Methionine aminopeptidase 1A -like protein [Gossypium arboreum] Length = 412 Score = 61.2 bits (147), Expect = 5e-07 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSILV 727 VKSYCGHGIG+LFHCAPNIPHY SILV Sbjct: 285 VKSYCGHGIGELFHCAPNIPHYGSILV 311 >ref|XP_020674539.1| methionine aminopeptidase 1A isoform X2 [Dendrobium catenatum] Length = 327 Score = 60.8 bits (146), Expect = 5e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSILV 727 VKSYCGHGIG+LFHCAPNIPHY SIL+ Sbjct: 298 VKSYCGHGIGELFHCAPNIPHYGSILI 324 >ref|NP_001325142.1| methionine aminopeptidase 1A [Arabidopsis thaliana] gb|ANM63026.1| methionine aminopeptidase 1A [Arabidopsis thaliana] Length = 330 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSILVLVNCY 712 V+SYCGHGIGDLFHCAPNIPHY+SIL CY Sbjct: 299 VRSYCGHGIGDLFHCAPNIPHYASIL----CY 326 >ref|XP_019189181.1| PREDICTED: methionine aminopeptidase 1A isoform X2 [Ipomoea nil] Length = 345 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSIL-VLVNCY 712 VKSYCGHGIG+LFHCAPNIPHY+SIL +LV Y Sbjct: 302 VKSYCGHGIGELFHCAPNIPHYASILGILVFIY 334 >gb|KJB49324.1| hypothetical protein B456_008G113300 [Gossypium raimondii] Length = 369 Score = 60.8 bits (146), Expect = 6e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSILV 727 VKSYCGHGIG+LFHCAPNIPHY SIL+ Sbjct: 302 VKSYCGHGIGELFHCAPNIPHYGSILI 328 >ref|XP_022641787.1| methionine aminopeptidase 1A isoform X2 [Vigna radiata var. radiata] Length = 325 Score = 60.1 bits (144), Expect = 1e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSIL 730 VKSYCGHGIG+LFHCAPNIPHY+SIL Sbjct: 298 VKSYCGHGIGELFHCAPNIPHYASIL 323 >gb|ACF82432.1| unknown [Zea mays] Length = 106 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYS 739 VKSYCGHGIG+LFHCAPNIPHYS Sbjct: 7 VKSYCGHGIGELFHCAPNIPHYS 29 >gb|PNT03372.1| hypothetical protein POPTR_014G067300v3 [Populus trichocarpa] Length = 334 Score = 59.7 bits (143), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSIL 730 VKSYCGHGIG+LFHCAPNIPHY SIL Sbjct: 302 VKSYCGHGIGELFHCAPNIPHYGSIL 327 >gb|PIA50111.1| hypothetical protein AQUCO_01300686v1, partial [Aquilegia coerulea] Length = 354 Score = 59.7 bits (143), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSIL 730 VKSYCGHGIG+LFHCAPNIPHY SIL Sbjct: 324 VKSYCGHGIGELFHCAPNIPHYGSIL 349 >gb|ONK73808.1| uncharacterized protein A4U43_C04F35600 [Asparagus officinalis] Length = 204 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYS 739 VKSYCGHGIGDLFHCAPNIPHYS Sbjct: 106 VKSYCGHGIGDLFHCAPNIPHYS 128 >gb|ONM05214.1| Methionine aminopeptidase 1A [Zea mays] Length = 164 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSI 733 VKSYCGHGIG+LFHCAPNIPHYS + Sbjct: 86 VKSYCGHGIGELFHCAPNIPHYSRV 110 >gb|OEL30060.1| Methionine aminopeptidase 1A [Dichanthelium oligosanthes] Length = 278 Score = 58.9 bits (141), Expect = 2e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSILVLVNCYRDFI 700 VKSYCGHGIG+LFHCAPNIPHYSS + + F+ Sbjct: 239 VKSYCGHGIGELFHCAPNIPHYSSTFLAASLISIFL 274 >ref|XP_020263462.1| methionine aminopeptidase 1A, partial [Asparagus officinalis] Length = 213 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYS 739 VKSYCGHGIGDLFHCAPNIPHYS Sbjct: 115 VKSYCGHGIGDLFHCAPNIPHYS 137 >ref|XP_021802971.1| methionine aminopeptidase 1A-like [Prunus avium] Length = 105 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYS 739 VKSYCGHGIG+LFHCAPNIPHY+ Sbjct: 22 VKSYCGHGIGELFHCAPNIPHYA 44 >gb|ESR58536.1| hypothetical protein CICLE_v10020473mg [Citrus clementina] Length = 349 Score = 58.9 bits (141), Expect = 3e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSSI 733 VKSYCGHGIG+LFHCAPNIPHYSS+ Sbjct: 300 VKSYCGHGIGELFHCAPNIPHYSSL 324 >ref|XP_014628947.1| PREDICTED: methionine aminopeptidase 1A-like isoform X3 [Glycine max] Length = 322 Score = 58.2 bits (139), Expect = 4e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYSS 736 VKSYCGHGIG+LFHCAPNIPHYSS Sbjct: 298 VKSYCGHGIGELFHCAPNIPHYSS 321 >ref|XP_020998165.1| methionine aminopeptidase 1A-like [Arachis duranensis] Length = 121 Score = 55.1 bits (131), Expect = 5e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHY 742 VKSYCGHGIG+LFHCAPNIPHY Sbjct: 76 VKSYCGHGIGELFHCAPNIPHY 97 >gb|KDO85764.1| hypothetical protein CISIN_1g0158381mg, partial [Citrus sinensis] Length = 200 Score = 56.6 bits (135), Expect = 5e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -2 Query: 807 VKSYCGHGIGDLFHCAPNIPHYS 739 VKSYCGHGIG+LFHCAPNIPHYS Sbjct: 110 VKSYCGHGIGELFHCAPNIPHYS 132