BLASTX nr result
ID: Ophiopogon26_contig00021086
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00021086 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252243.1| lisH domain and HEAT repeat-containing prote... 64 5e-09 >ref|XP_020252243.1| lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Asparagus officinalis] Length = 1186 Score = 64.3 bits (155), Expect = 5e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 63 DGTRFQRMMRGGFGDMLRGKGKGTEDSPGKPS 158 DGTRFQRMMRGG G+MLRGKGKG EDSPGKP+ Sbjct: 1155 DGTRFQRMMRGGLGEMLRGKGKGPEDSPGKPA 1186