BLASTX nr result
ID: Ophiopogon26_contig00021047
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00021047 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK58882.1| uncharacterized protein A4U43_C08F700 [Asparagus ... 64 7e-11 ref|XP_020241067.1| LOW QUALITY PROTEIN: probable chromo domain-... 64 2e-09 >gb|ONK58882.1| uncharacterized protein A4U43_C08F700 [Asparagus officinalis] Length = 99 Score = 63.9 bits (154), Expect = 7e-11 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 354 KELKVKNPLLLISFYEQHLRYSPPTCDVNEQQ 259 K+LK+ NPL+LI+FYEQHLRYSPPTCDVNEQQ Sbjct: 67 KDLKLNNPLVLINFYEQHLRYSPPTCDVNEQQ 98 >ref|XP_020241067.1| LOW QUALITY PROTEIN: probable chromo domain-containing protein LHP1 [Asparagus officinalis] Length = 330 Score = 63.9 bits (154), Expect = 2e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 354 KELKVKNPLLLISFYEQHLRYSPPTCDVNEQQ 259 K+LK+ NPL+LI+FYEQHLRYSPPTCDVNEQQ Sbjct: 298 KDLKLNNPLVLINFYEQHLRYSPPTCDVNEQQ 329