BLASTX nr result
ID: Ophiopogon26_contig00020688
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00020688 (530 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA54856.1| hypothetical protein AXF42_Ash000691 [Apostasia s... 62 7e-08 ref|XP_020086727.1| BSD domain-containing protein 1-like, partia... 56 5e-06 ref|XP_009412174.1| PREDICTED: BSD domain-containing protein 1-l... 56 7e-06 gb|OAY71102.1| BSD domain-containing protein 1 [Ananas comosus] 55 9e-06 >gb|PKA54856.1| hypothetical protein AXF42_Ash000691 [Apostasia shenzhenica] Length = 491 Score = 61.6 bits (148), Expect = 7e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 87 QPSIPEEDDLGWDEIEDLGEHEDKKVAGS 1 QPS+PEE+DLGWDEIEDLGEHEDKKV GS Sbjct: 428 QPSLPEEEDLGWDEIEDLGEHEDKKVGGS 456 >ref|XP_020086727.1| BSD domain-containing protein 1-like, partial [Ananas comosus] Length = 497 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 1/30 (3%) Frame = -3 Query: 87 QPSIPEEDDLGWDEIEDLGEHEDKKV-AGS 1 QPS+P+EDDL WDEIEDLGEHEDKKV AGS Sbjct: 433 QPSVPDEDDLEWDEIEDLGEHEDKKVGAGS 462 >ref|XP_009412174.1| PREDICTED: BSD domain-containing protein 1-like [Musa acuminata subsp. malaccensis] Length = 471 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -3 Query: 87 QPSIPEEDDLGWDEIEDLGEHEDKKVAGS 1 Q S PEEDDLGWDEIEDLGEH++KKV GS Sbjct: 406 QNSTPEEDDLGWDEIEDLGEHDEKKVGGS 434 >gb|OAY71102.1| BSD domain-containing protein 1 [Ananas comosus] Length = 484 Score = 55.5 bits (132), Expect = 9e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 87 QPSIPEEDDLGWDEIEDLGEHEDKKVAGS 1 QPS+P+EDDL WDEIEDLGEHEDK+V S Sbjct: 409 QPSVPDEDDLEWDEIEDLGEHEDKEVGAS 437