BLASTX nr result
ID: Ophiopogon26_contig00020447
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00020447 (448 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267381.1| uncharacterized protein LOC109842885 [Aspara... 73 8e-13 >ref|XP_020267381.1| uncharacterized protein LOC109842885 [Asparagus officinalis] gb|ONK68089.1| uncharacterized protein A4U43_C05F7330 [Asparagus officinalis] Length = 212 Score = 72.8 bits (177), Expect = 8e-13 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = -1 Query: 169 MACRSINLYSPLVRPRRAITDQTPAIGYWQHEAGKFRFQRSIVLCCAAQESSTTAT 2 MACRSIN+Y L+RPRR I DQ+P I + +EAG+ R +VLCC+A ESS+TAT Sbjct: 1 MACRSINMYGSLLRPRRIIADQSPVISFRPNEAGRLGVNRRVVLCCSAPESSSTAT 56