BLASTX nr result
ID: Ophiopogon26_contig00020285
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00020285 (543 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA06491.1| hypothetical protein SOVF_180620 isoform B [Spina... 70 5e-11 gb|ONK71855.1| uncharacterized protein A4U43_C04F13080 [Asparagu... 67 1e-10 ref|XP_020273108.1| endoplasmic reticulum oxidoreductin-1-like [... 67 8e-10 gb|KMS98074.1| hypothetical protein BVRB_4g095870 [Beta vulgaris... 67 1e-09 ref|XP_010694837.1| PREDICTED: endoplasmic reticulum oxidoreduct... 67 1e-09 gb|ONK64411.1| uncharacterized protein A4U43_C07F25620 [Asparagu... 67 1e-09 gb|KNA06490.1| hypothetical protein SOVF_180620 isoform A [Spina... 65 3e-09 ref|XP_021866898.1| endoplasmic reticulum oxidoreductin-1 [Spina... 65 4e-09 ref|XP_020686747.1| endoplasmic reticulum oxidoreductin-1-like [... 64 1e-08 ref|XP_015888362.1| PREDICTED: endoplasmic reticulum oxidoreduct... 64 1e-08 ref|XP_019159165.1| PREDICTED: endoplasmic reticulum oxidoreduct... 63 3e-08 ref|XP_019159164.1| PREDICTED: endoplasmic reticulum oxidoreduct... 63 3e-08 ref|XP_019159163.1| PREDICTED: endoplasmic reticulum oxidoreduct... 63 3e-08 ref|XP_016447449.1| PREDICTED: endoplasmic reticulum oxidoreduct... 58 7e-08 ref|XP_015690057.1| PREDICTED: endoplasmic reticulum oxidoreduct... 61 1e-07 ref|XP_008794025.1| PREDICTED: endoplasmic reticulum oxidoreduct... 61 1e-07 ref|XP_018805857.1| PREDICTED: endoplasmic reticulum oxidoreduct... 57 1e-07 ref|XP_020587405.1| endoplasmic reticulum oxidoreductin-1 [Phala... 61 1e-07 ref|XP_022877700.1| endoplasmic reticulum oxidoreductin-1, parti... 61 1e-07 ref|XP_010275885.1| PREDICTED: endoplasmic reticulum oxidoreduct... 60 2e-07 >gb|KNA06491.1| hypothetical protein SOVF_180620 isoform B [Spinacia oleracea] Length = 358 Score = 70.5 bits (171), Expect = 5e-11 Identities = 36/62 (58%), Positives = 46/62 (74%) Frame = +2 Query: 14 NQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVFSIAKTW 193 NQP++LQRNEVIALLNLLNRLSES+ V +M P +DKI+ GQ S P S+ V ++ + W Sbjct: 290 NQPLQLQRNEVIALLNLLNRLSESVKLVHEMAPSVDKIV---GQVSGPPSQKVGTLQRIW 346 Query: 194 NS 199 S Sbjct: 347 QS 348 >gb|ONK71855.1| uncharacterized protein A4U43_C04F13080 [Asparagus officinalis] Length = 165 Score = 67.0 bits (162), Expect = 1e-10 Identities = 36/57 (63%), Positives = 40/57 (70%) Frame = +2 Query: 2 QGLTNQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTV 172 Q NQP++LQRNEVIA LNLLNRLSES+ FVRKM P DK M GQ PA +V Sbjct: 109 QSTKNQPLQLQRNEVIAFLNLLNRLSESVDFVRKMAPQFDKFME--GQHYHPAGGSV 163 >ref|XP_020273108.1| endoplasmic reticulum oxidoreductin-1-like [Asparagus officinalis] Length = 342 Score = 67.0 bits (162), Expect = 8e-10 Identities = 36/57 (63%), Positives = 40/57 (70%) Frame = +2 Query: 2 QGLTNQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTV 172 Q NQP++LQRNEVIA LNLLNRLSES+ FVRKM P DK M GQ PA +V Sbjct: 286 QSTKNQPLQLQRNEVIAFLNLLNRLSESVDFVRKMAPQFDKFME--GQHYHPAGGSV 340 >gb|KMS98074.1| hypothetical protein BVRB_4g095870 [Beta vulgaris subsp. vulgaris] Length = 444 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/62 (54%), Positives = 45/62 (72%) Frame = +2 Query: 14 NQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVFSIAKTW 193 NQP++LQRNEVIAL+NLLNRLSES+ V +M P DKI+ GQ + P S+ V ++ + W Sbjct: 376 NQPLQLQRNEVIALINLLNRLSESVKLVHEMAPSADKIV---GQVAGPPSQEVSTMRRIW 432 Query: 194 NS 199 S Sbjct: 433 QS 434 >ref|XP_010694837.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Beta vulgaris subsp. vulgaris] Length = 466 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/62 (54%), Positives = 45/62 (72%) Frame = +2 Query: 14 NQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVFSIAKTW 193 NQP++LQRNEVIAL+NLLNRLSES+ V +M P DKI+ GQ + P S+ V ++ + W Sbjct: 398 NQPLQLQRNEVIALINLLNRLSESVKLVHEMAPSADKIV---GQVAGPPSQEVSTMRRIW 454 Query: 194 NS 199 S Sbjct: 455 QS 456 >gb|ONK64411.1| uncharacterized protein A4U43_C07F25620 [Asparagus officinalis] Length = 489 Score = 67.0 bits (162), Expect = 1e-09 Identities = 36/57 (63%), Positives = 40/57 (70%) Frame = +2 Query: 2 QGLTNQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTV 172 Q NQP++LQRNEVIA LNLLNRLSES+ FVRKM P DK M GQ PA +V Sbjct: 433 QSTKNQPLQLQRNEVIAFLNLLNRLSESVDFVRKMAPQFDKFME--GQHYHPAGGSV 487 >gb|KNA06490.1| hypothetical protein SOVF_180620 isoform A [Spinacia oleracea] Length = 360 Score = 65.5 bits (158), Expect = 3e-09 Identities = 36/64 (56%), Positives = 46/64 (71%), Gaps = 2/64 (3%) Frame = +2 Query: 14 NQPVKLQ--RNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVFSIAK 187 NQP++LQ RNEVIALLNLLNRLSES+ V +M P +DKI+ GQ S P S+ V ++ + Sbjct: 290 NQPLQLQLQRNEVIALLNLLNRLSESVKLVHEMAPSVDKIV---GQVSGPPSQKVGTLQR 346 Query: 188 TWNS 199 W S Sbjct: 347 IWQS 350 >ref|XP_021866898.1| endoplasmic reticulum oxidoreductin-1 [Spinacia oleracea] Length = 468 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/64 (56%), Positives = 46/64 (71%), Gaps = 2/64 (3%) Frame = +2 Query: 14 NQPVKLQ--RNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVFSIAK 187 NQP++LQ RNEVIALLNLLNRLSES+ V +M P +DKI+ GQ S P S+ V ++ + Sbjct: 398 NQPLQLQLQRNEVIALLNLLNRLSESVKLVHEMAPSVDKIV---GQVSGPPSQKVGTLQR 454 Query: 188 TWNS 199 W S Sbjct: 455 IWQS 458 >ref|XP_020686747.1| endoplasmic reticulum oxidoreductin-1-like [Dendrobium catenatum] gb|PKU64309.1| Endoplasmic oxidoreductin-1 [Dendrobium catenatum] Length = 452 Score = 63.9 bits (154), Expect = 1e-08 Identities = 35/56 (62%), Positives = 43/56 (76%) Frame = +2 Query: 2 QGLTNQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKT 169 Q NQP++LQRNEVIAL+NLLNRLSES++FVR+M P + IM + SSPA KT Sbjct: 397 QNHLNQPLQLQRNEVIALVNLLNRLSESVNFVREMGPSAENIME--RRPSSPARKT 450 >ref|XP_015888362.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Ziziphus jujuba] Length = 481 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/62 (54%), Positives = 44/62 (70%) Frame = +2 Query: 14 NQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVFSIAKTW 193 +QPV+LQRNEVIALLNLLNRLSES+ V + P I+KI+ GG PA++ + +TW Sbjct: 412 DQPVQLQRNEVIALLNLLNRLSESVKLVHEKGPSIEKILEGG--IVEPAAQKITKWLRTW 469 Query: 194 NS 199 S Sbjct: 470 KS 471 >ref|XP_019159165.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X3 [Ipomoea nil] ref|XP_019159166.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X4 [Ipomoea nil] Length = 464 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +2 Query: 17 QPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAG 136 QP++LQRNEVIAL+NLLNRLSESI FVR+M P I+K+M G Sbjct: 395 QPLQLQRNEVIALMNLLNRLSESISFVREMSPDIEKVMEG 434 >ref|XP_019159164.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X2 [Ipomoea nil] Length = 479 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +2 Query: 17 QPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAG 136 QP++LQRNEVIAL+NLLNRLSESI FVR+M P I+K+M G Sbjct: 395 QPLQLQRNEVIALMNLLNRLSESISFVREMSPDIEKVMEG 434 >ref|XP_019159163.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X1 [Ipomoea nil] Length = 490 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +2 Query: 17 QPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAG 136 QP++LQRNEVIAL+NLLNRLSESI FVR+M P I+K+M G Sbjct: 395 QPLQLQRNEVIALMNLLNRLSESISFVREMSPDIEKVMEG 434 >ref|XP_016447449.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Nicotiana tabacum] Length = 101 Score = 58.2 bits (139), Expect = 7e-08 Identities = 31/62 (50%), Positives = 43/62 (69%) Frame = +2 Query: 14 NQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVFSIAKTW 193 +Q ++LQRNEVIAL+NLLNRLSESI V++M P +K + GG PA+K + S + W Sbjct: 37 DQHLQLQRNEVIALVNLLNRLSESIKLVQEMSPTFEKTI--GGLSLQPAAKLISSWKRLW 94 Query: 194 NS 199 + Sbjct: 95 ET 96 >ref|XP_015690057.1| PREDICTED: endoplasmic reticulum oxidoreductin-1, partial [Oryza brachyantha] Length = 429 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = +2 Query: 14 NQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVF 175 NQP++LQRNEVIAL+NLLNRLSES++FV + P I++++ Q SSP K VF Sbjct: 377 NQPLQLQRNEVIALVNLLNRLSESVNFVHEKGPSIEEVIK---QQSSPTVKPVF 427 >ref|XP_008794025.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X1 [Phoenix dactylifera] Length = 454 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = +2 Query: 2 QGLTNQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKT 169 Q L NQ ++LQRNEVIAL+NLLNRLSES+ V +M P I+KIM GQ S P K+ Sbjct: 399 QNLMNQHLQLQRNEVIALVNLLNRLSESVKLVHEMGPSIEKIME--GQFSPPTRKS 452 >ref|XP_018805857.1| PREDICTED: endoplasmic reticulum oxidoreductin-2-like [Juglans regia] Length = 103 Score = 57.4 bits (137), Expect = 1e-07 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +2 Query: 14 NQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSP 157 +Q ++LQRNEVIAL+NLLNRLSES+ VR+M P ++KIM GQ SSP Sbjct: 38 DQTLQLQRNEVIALMNLLNRLSESVKCVREMGPSVEKIME--GQISSP 83 >ref|XP_020587405.1| endoplasmic reticulum oxidoreductin-1 [Phalaenopsis equestris] ref|XP_020587406.1| endoplasmic reticulum oxidoreductin-1 [Phalaenopsis equestris] Length = 448 Score = 60.8 bits (146), Expect = 1e-07 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = +2 Query: 2 QGLTNQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASK 166 Q NQP++LQRNEVIAL+NLLNRLSES++FV +M P + IM + SSPA K Sbjct: 393 QNHANQPLQLQRNEVIALVNLLNRLSESVNFVHQMGPAAENIME--RRSSSPARK 445 >ref|XP_022877700.1| endoplasmic reticulum oxidoreductin-1, partial [Olea europaea var. sylvestris] Length = 452 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 2 QGLTNQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIM 130 Q NQP++LQRNEVIAL+NLLNRLSESI FV ++VP ++K M Sbjct: 395 QNYPNQPLQLQRNEVIALVNLLNRLSESIKFVEEIVPSVEKTM 437 >ref|XP_010275885.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Nelumbo nucifera] Length = 461 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = +2 Query: 14 NQPVKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKT 169 NQP++LQRNEVIAL+NLLNRLSES+ F +M P +KIM G S S T Sbjct: 399 NQPLQLQRNEVIALVNLLNRLSESVKFAHEMGPAAEKIMEGQVSAPSTPSST 450