BLASTX nr result
ID: Ophiopogon26_contig00020267
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00020267 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010242434.1| PREDICTED: proline-, glutamic acid- and leuc... 59 1e-07 ref|XP_010242433.1| PREDICTED: proline-, glutamic acid- and leuc... 59 1e-07 ref|XP_010242432.1| PREDICTED: proline-, glutamic acid- and leuc... 59 1e-07 ref|XP_010242430.1| PREDICTED: proline-, glutamic acid- and leuc... 59 1e-07 ref|XP_010242429.1| PREDICTED: proline-, glutamic acid- and leuc... 59 1e-07 ref|XP_019710746.1| PREDICTED: proline-, glutamic acid- and leuc... 59 2e-07 ref|XP_020247498.1| proline-, glutamic acid- and leucine-rich pr... 59 2e-07 ref|XP_020247497.1| proline-, glutamic acid- and leucine-rich pr... 59 2e-07 ref|XP_008807711.1| PREDICTED: proline-, glutamic acid- and leuc... 59 2e-07 ref|XP_010939528.1| PREDICTED: proline-, glutamic acid- and leuc... 59 2e-07 ref|XP_018842583.1| PREDICTED: proline-, glutamic acid- and leuc... 58 4e-07 ref|XP_019080826.1| PREDICTED: proline-, glutamic acid- and leuc... 58 4e-07 ref|XP_018842582.1| PREDICTED: proline-, glutamic acid- and leuc... 58 4e-07 emb|CBI35005.3| unnamed protein product, partial [Vitis vinifera] 58 4e-07 ref|XP_023881665.1| uncharacterized protein LOC111994038 [Quercu... 56 1e-06 ref|XP_009403178.1| PREDICTED: proline-, glutamic acid- and leuc... 56 1e-06 gb|POE73990.1| hypothetical protein CFP56_45335 [Quercus suber] 56 1e-06 ref|XP_020585287.1| proline-, glutamic acid- and leucine-rich pr... 56 2e-06 gb|OVA09040.1| hypothetical protein BVC80_9097g108 [Macleaya cor... 56 2e-06 emb|CDO99903.1| unnamed protein product [Coffea canephora] 55 3e-06 >ref|XP_010242434.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1-like isoform X5 [Nelumbo nucifera] Length = 879 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL ASLLSP +RPPYLSQGLELFRRG Sbjct: 567 FQLAALRALLASLLSPARVRPPYLSQGLELFRRG 600 >ref|XP_010242433.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1-like isoform X4 [Nelumbo nucifera] Length = 880 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL ASLLSP +RPPYLSQGLELFRRG Sbjct: 568 FQLAALRALLASLLSPARVRPPYLSQGLELFRRG 601 >ref|XP_010242432.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1-like isoform X3 [Nelumbo nucifera] Length = 899 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL ASLLSP +RPPYLSQGLELFRRG Sbjct: 587 FQLAALRALLASLLSPARVRPPYLSQGLELFRRG 620 >ref|XP_010242430.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1-like isoform X2 [Nelumbo nucifera] Length = 899 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL ASLLSP +RPPYLSQGLELFRRG Sbjct: 587 FQLAALRALLASLLSPARVRPPYLSQGLELFRRG 620 >ref|XP_010242429.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1-like isoform X1 [Nelumbo nucifera] Length = 900 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL ASLLSP +RPPYLSQGLELFRRG Sbjct: 588 FQLAALRALLASLLSPARVRPPYLSQGLELFRRG 621 >ref|XP_019710746.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1 isoform X2 [Elaeis guineensis] Length = 789 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL+AL ASLLS H+RPPYLS+GLELFRRG Sbjct: 472 FQLAALQALLASLLSQAHVRPPYLSEGLELFRRG 505 >ref|XP_020247498.1| proline-, glutamic acid- and leucine-rich protein 1 isoform X2 [Asparagus officinalis] Length = 856 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL LEAL ASLLS H+RPPYLSQGLE+FRRG Sbjct: 578 FQLAGLEALLASLLSSAHVRPPYLSQGLEIFRRG 611 >ref|XP_020247497.1| proline-, glutamic acid- and leucine-rich protein 1 isoform X1 [Asparagus officinalis] gb|ONK56694.1| uncharacterized protein A4U43_C10F11740 [Asparagus officinalis] Length = 857 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL LEAL ASLLS H+RPPYLSQGLE+FRRG Sbjct: 579 FQLAGLEALLASLLSSAHVRPPYLSQGLEIFRRG 612 >ref|XP_008807711.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1 [Phoenix dactylifera] Length = 882 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL+AL ASLLS H+RPPYLS+GLELFRRG Sbjct: 583 FQLAALQALLASLLSQAHVRPPYLSEGLELFRRG 616 >ref|XP_010939528.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1 isoform X1 [Elaeis guineensis] Length = 900 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL+AL ASLLS H+RPPYLS+GLELFRRG Sbjct: 583 FQLAALQALLASLLSQAHVRPPYLSEGLELFRRG 616 >ref|XP_018842583.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1 isoform X2 [Juglans regia] Length = 815 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL ASLLS VH+RPPYL+QGLELF+RG Sbjct: 512 FQLAALRALLASLLSSVHVRPPYLAQGLELFQRG 545 >ref|XP_019080826.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1 [Vitis vinifera] Length = 886 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL ASLLSP +RPPYL+QGLELFRRG Sbjct: 587 FQLAALRALLASLLSPARVRPPYLAQGLELFRRG 620 >ref|XP_018842582.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1 isoform X1 [Juglans regia] Length = 893 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL ASLLS VH+RPPYL+QGLELF+RG Sbjct: 590 FQLAALRALLASLLSSVHVRPPYLAQGLELFQRG 623 >emb|CBI35005.3| unnamed protein product, partial [Vitis vinifera] Length = 937 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL ASLLSP +RPPYL+QGLELFRRG Sbjct: 586 FQLAALRALLASLLSPARVRPPYLAQGLELFRRG 619 >ref|XP_023881665.1| uncharacterized protein LOC111994038 [Quercus suber] Length = 856 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL +SLLS V +RPPYLSQGLELFRRG Sbjct: 588 FQLAALRALLSSLLSSVRVRPPYLSQGLELFRRG 621 >ref|XP_009403178.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1 [Musa acuminata subsp. malaccensis] ref|XP_018683559.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1 [Musa acuminata subsp. malaccensis] Length = 874 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 272 QLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 QL AL AL ASLLSP H+RPPYLS+GLELFR+G Sbjct: 581 QLAALRALLASLLSPSHVRPPYLSEGLELFRQG 613 >gb|POE73990.1| hypothetical protein CFP56_45335 [Quercus suber] Length = 1127 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL +SLLS V +RPPYLSQGLELFRRG Sbjct: 859 FQLAALRALLSSLLSSVRVRPPYLSQGLELFRRG 892 >ref|XP_020585287.1| proline-, glutamic acid- and leucine-rich protein 1-like [Phalaenopsis equestris] Length = 620 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL ALEAL ASLLSP RPPYLSQGL LF+RG Sbjct: 348 FQLAALEALLASLLSPTETRPPYLSQGLNLFQRG 381 >gb|OVA09040.1| hypothetical protein BVC80_9097g108 [Macleaya cordata] Length = 877 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRG 174 FQL AL AL ASLLSP +RPP+LSQGL+LFRRG Sbjct: 585 FQLAALHALLASLLSPARVRPPHLSQGLDLFRRG 618 >emb|CDO99903.1| unnamed protein product [Coffea canephora] Length = 847 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 275 FQLVALEALFASLLSPVHIRPPYLSQGLELFRRGT 171 FQL AL AL ASLLSP +RPP+L+QGLELFRRG+ Sbjct: 521 FQLAALRALLASLLSPGRVRPPHLAQGLELFRRGS 555