BLASTX nr result
ID: Ophiopogon26_contig00019660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00019660 (930 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020243626.1| protein FATTY ACID EXPORT 3, chloroplastic [... 69 1e-09 >ref|XP_020243626.1| protein FATTY ACID EXPORT 3, chloroplastic [Asparagus officinalis] Length = 351 Score = 69.3 bits (168), Expect = 1e-09 Identities = 40/65 (61%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = +3 Query: 738 QLDAHSARRLDFGRGILAFDRRTRRDSSVFAS-DESTHPDIEVEKVKDELKTDANKAEEA 914 Q +A ARRLD G G L+FD R +S + AS DEST+PDIEVEK DELK +ANKAEE Sbjct: 72 QFNALKARRLDSGLGFLSFDLRIGGNSLIAASFDESTNPDIEVEK--DELKPEANKAEEE 129 Query: 915 WKETL 929 WK+ L Sbjct: 130 WKKAL 134