BLASTX nr result
ID: Ophiopogon26_contig00019554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00019554 (605 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020243985.1| cell number regulator 6-like [Asparagus offi... 75 5e-13 ref|XP_010934658.1| PREDICTED: cell number regulator 6-like [Ela... 65 2e-09 gb|OAY65062.1| Cell number regulator 6 [Ananas comosus] 61 5e-08 ref|XP_020114504.1| cell number regulator 6 [Ananas comosus] 61 7e-08 ref|XP_008813031.1| PREDICTED: cell number regulator 6-like [Pho... 60 3e-07 ref|XP_010933640.1| PREDICTED: cell number regulator 6 [Elaeis g... 57 2e-06 ref|XP_020685388.1| cell number regulator 6-like [Dendrobium cat... 56 5e-06 >ref|XP_020243985.1| cell number regulator 6-like [Asparagus officinalis] gb|ONK59142.1| uncharacterized protein A4U43_C08F3420 [Asparagus officinalis] Length = 238 Score = 75.5 bits (184), Expect = 5e-13 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 604 AVMPMTVLNPPPVQEMNANENQEPETSENGVQSQHATLEMQAL 476 +VMPMTV+NPPPVQEMNAN+NQE + SENG QSQ ATLEMQAL Sbjct: 196 SVMPMTVVNPPPVQEMNANDNQESQASENGTQSQRATLEMQAL 238 >ref|XP_010934658.1| PREDICTED: cell number regulator 6-like [Elaeis guineensis] Length = 239 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -2 Query: 598 MPMTVLNPPPVQEMNANENQEPETSENGVQSQHATLEMQAL 476 M MT++NPP VQEMNANEN+E +SENGVQ+QHA+LE+QA+ Sbjct: 198 MQMTIINPPEVQEMNANENKETASSENGVQNQHASLEIQAV 238 >gb|OAY65062.1| Cell number regulator 6 [Ananas comosus] Length = 188 Score = 60.8 bits (146), Expect = 5e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -2 Query: 601 VMPMTVLNPPPVQEMNANENQEPETSENGVQSQHATLEMQAL 476 VMPMT++NPP VQEMN NEN+E SENGV +QH +E+Q L Sbjct: 147 VMPMTIINPPVVQEMNVNENRESAGSENGVHNQHTEVEIQPL 188 >ref|XP_020114504.1| cell number regulator 6 [Ananas comosus] Length = 238 Score = 61.2 bits (147), Expect = 7e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -2 Query: 601 VMPMTVLNPPPVQEMNANENQEPETSENGVQSQHATLEMQAL 476 VMPMT++NPP VQEMN NEN+E SENGV +QH +E+Q L Sbjct: 197 VMPMTIINPPAVQEMNVNENRESAGSENGVHNQHTEVEIQPL 238 >ref|XP_008813031.1| PREDICTED: cell number regulator 6-like [Phoenix dactylifera] Length = 240 Score = 59.7 bits (143), Expect = 3e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -2 Query: 598 MPMTVLNPPPVQEMNANENQEPETSENGVQSQHATLEMQAL 476 M MT++NPP VQEMNANEN+E +SEN VQ+Q A+LE+QA+ Sbjct: 199 MQMTIINPPAVQEMNANENKETASSENDVQNQQASLEIQAV 239 >ref|XP_010933640.1| PREDICTED: cell number regulator 6 [Elaeis guineensis] Length = 240 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/43 (62%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -2 Query: 601 VMPMTVLNPPPVQEMNANENQEPETSENGVQ-SQHATLEMQAL 476 +MPMTV+NPPPVQEM+ NEN S+ G Q ++HATLEM+AL Sbjct: 198 IMPMTVVNPPPVQEMSMNENHGSSASDAGAQKNEHATLEMEAL 240 >ref|XP_020685388.1| cell number regulator 6-like [Dendrobium catenatum] Length = 241 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/44 (68%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = -2 Query: 601 VMPMTVLNPPPVQEMNANENQEPETSEN-GVQSQHA-TLEMQAL 476 V PMTV+NPP +QEM+AN+NQE S N G+Q+QHA TLEMQAL Sbjct: 198 VTPMTVVNPPAIQEMSANQNQESVASGNGGLQNQHATTLEMQAL 241