BLASTX nr result
ID: Ophiopogon26_contig00019536
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00019536 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008777433.1| PREDICTED: NF-kappa-B-activating protein [Ph... 54 1e-05 >ref|XP_008777433.1| PREDICTED: NF-kappa-B-activating protein [Phoenix dactylifera] Length = 499 Score = 53.5 bits (127), Expect = 1e-05 Identities = 28/66 (42%), Positives = 33/66 (50%) Frame = -3 Query: 291 SNNNNKPWXXXXXXXXXXXELKGLTYFEYXXXXXXXXXXXXKNCIWRVTPSPPRADRDQS 112 S N P +LKGL+YFEY KNCIWRVTPSPPR +RD S Sbjct: 85 SRNGKPPSLGDGDSSSDDEDLKGLSYFEYRRLKRQKLRKKLKNCIWRVTPSPPRGERDPS 144 Query: 111 DDDEPP 94 + + P Sbjct: 145 EPLDGP 150