BLASTX nr result
ID: Ophiopogon26_contig00019475
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00019475 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OVA12159.1| Aminotransferase-like [Macleaya cordata] 55 1e-07 >gb|OVA12159.1| Aminotransferase-like [Macleaya cordata] Length = 253 Score = 54.7 bits (130), Expect(2) = 1e-07 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -3 Query: 114 RWWDTTLSFHLPCNELRFTPLD*TMLTGLSIGIDNPPP 1 RWWDTT +FH E+ FTPLD T LTG+SIG +PPP Sbjct: 45 RWWDTTHTFHFLKLEIGFTPLDFTFLTGISIGSGDPPP 82 Score = 28.5 bits (62), Expect(2) = 1e-07 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 202 KELIDQAGWNRFFMINTEKSSMRFVEALVE 113 KELID W+R F I + +E L+E Sbjct: 15 KELIDLCCWDRLFTITVGNGDKKIMEGLIE 44