BLASTX nr result
ID: Ophiopogon26_contig00019282
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00019282 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268472.1| protein RRP6-like 2 [Asparagus officinalis] ... 76 5e-13 >ref|XP_020268472.1| protein RRP6-like 2 [Asparagus officinalis] gb|ONK68872.1| uncharacterized protein A4U43_C05F16920 [Asparagus officinalis] Length = 906 Score = 75.9 bits (185), Expect = 5e-13 Identities = 38/57 (66%), Positives = 43/57 (75%) Frame = -2 Query: 455 FTGVGEHNGDVGLDSNPMDSGEKRRASALGRSNGEGRERGLRRQAFPPSGNRSTTYK 285 F GV EH D LD+NP +S EKR+ S GRS+GE R RGLRRQAFP SGNRST+YK Sbjct: 850 FGGVEEHFKDAELDNNPSESTEKRKGSDKGRSSGEERVRGLRRQAFPASGNRSTSYK 906