BLASTX nr result
ID: Ophiopogon26_contig00019248
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00019248 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240768.1| extra-large guanine nucleotide-binding prote... 57 7e-11 ref|XP_020240770.1| extra-large guanine nucleotide-binding prote... 57 7e-11 ref|XP_020240771.1| extra-large guanine nucleotide-binding prote... 57 7e-11 ref|XP_008810159.1| PREDICTED: extra-large guanine nucleotide-bi... 54 6e-10 ref|XP_008810161.1| PREDICTED: extra-large guanine nucleotide-bi... 54 6e-10 ref|XP_010943448.1| PREDICTED: extra-large guanine nucleotide-bi... 56 7e-10 ref|XP_013586629.1| PREDICTED: extra-large guanine nucleotide-bi... 57 9e-10 ref|XP_013660501.1| extra-large guanine nucleotide-binding prote... 57 9e-10 emb|CDY12271.1| BnaA09g24710D [Brassica napus] 54 1e-09 ref|XP_013586984.1| PREDICTED: extra-large guanine nucleotide-bi... 54 1e-09 ref|XP_009114940.1| PREDICTED: extra-large guanine nucleotide-bi... 54 1e-09 ref|XP_013586986.1| PREDICTED: extra-large guanine nucleotide-bi... 54 1e-09 ref|XP_010478615.1| PREDICTED: extra-large guanine nucleotide-bi... 52 2e-09 ref|XP_020693721.1| extra-large guanine nucleotide-binding prote... 55 3e-09 ref|XP_020868438.1| extra-large guanine nucleotide-binding prote... 52 3e-09 ref|XP_010499742.1| PREDICTED: extra-large guanine nucleotide-bi... 52 4e-09 gb|OAP18477.1| XLG3 [Arabidopsis thaliana] 51 8e-09 ref|NP_174475.1| extra-large GTP-binding protein 3 [Arabidopsis ... 51 8e-09 ref|XP_013749173.1| extra-large guanine nucleotide-binding prote... 54 1e-08 ref|XP_009145218.1| PREDICTED: extra-large guanine nucleotide-bi... 54 1e-08 >ref|XP_020240768.1| extra-large guanine nucleotide-binding protein 3 isoform X1 [Asparagus officinalis] Length = 870 Score = 57.0 bits (136), Expect(2) = 7e-11 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGCPLRPEEMA+ LNC LP Sbjct: 280 ANQLRPEQLIVNGCPLRPEEMADLLNCSLP 309 Score = 37.4 bits (85), Expect(2) = 7e-11 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPPQKLKPGRY + KE Sbjct: 303 LLNCSLPPQKLKPGRYWYDKE 323 >ref|XP_020240770.1| extra-large guanine nucleotide-binding protein 3 isoform X2 [Asparagus officinalis] Length = 869 Score = 57.0 bits (136), Expect(2) = 7e-11 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGCPLRPEEMA+ LNC LP Sbjct: 280 ANQLRPEQLIVNGCPLRPEEMADLLNCSLP 309 Score = 37.4 bits (85), Expect(2) = 7e-11 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPPQKLKPGRY + KE Sbjct: 303 LLNCSLPPQKLKPGRYWYDKE 323 >ref|XP_020240771.1| extra-large guanine nucleotide-binding protein 3 isoform X3 [Asparagus officinalis] gb|ONK58938.1| uncharacterized protein A4U43_C08F1280 [Asparagus officinalis] Length = 867 Score = 57.0 bits (136), Expect(2) = 7e-11 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGCPLRPEEMA+ LNC LP Sbjct: 280 ANQLRPEQLIVNGCPLRPEEMADLLNCSLP 309 Score = 37.4 bits (85), Expect(2) = 7e-11 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPPQKLKPGRY + KE Sbjct: 303 LLNCSLPPQKLKPGRYWYDKE 323 >ref|XP_008810159.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Phoenix dactylifera] ref|XP_008810160.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Phoenix dactylifera] ref|XP_017701810.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Phoenix dactylifera] Length = 861 Score = 53.9 bits (128), Expect(2) = 6e-10 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGC LRP+EMAE L+CQLP Sbjct: 274 ANQLRPEQLIVNGCSLRPDEMAELLSCQLP 303 Score = 37.4 bits (85), Expect(2) = 6e-10 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + +CQLPPQKLKPGRY + KE Sbjct: 297 LLSCQLPPQKLKPGRYWYDKE 317 >ref|XP_008810161.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X2 [Phoenix dactylifera] Length = 858 Score = 53.9 bits (128), Expect(2) = 6e-10 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGC LRP+EMAE L+CQLP Sbjct: 274 ANQLRPEQLIVNGCSLRPDEMAELLSCQLP 303 Score = 37.4 bits (85), Expect(2) = 6e-10 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + +CQLPPQKLKPGRY + KE Sbjct: 297 LLSCQLPPQKLKPGRYWYDKE 317 >ref|XP_010943448.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Elaeis guineensis] Length = 858 Score = 55.8 bits (133), Expect(2) = 7e-10 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGCPLRPEEMAE L+C LP Sbjct: 274 ANQLRPEQLIVNGCPLRPEEMAELLSCPLP 303 Score = 35.0 bits (79), Expect(2) = 7e-10 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + +C LPPQKLKPGRY + KE Sbjct: 297 LLSCPLPPQKLKPGRYWYDKE 317 >ref|XP_013586629.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Brassica oleracea var. oleracea] ref|XP_013586630.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Brassica oleracea var. oleracea] ref|XP_013586631.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Brassica oleracea var. oleracea] Length = 840 Score = 57.0 bits (136), Expect(2) = 9e-10 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QLVVNGCPL+PEEMAE LNC LP Sbjct: 251 ANQLRPEQLVVNGCPLKPEEMAELLNCPLP 280 Score = 33.5 bits (75), Expect(2) = 9e-10 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPP+KLKPG Y + KE Sbjct: 274 LLNCPLPPEKLKPGSYWYDKE 294 >ref|XP_013660501.1| extra-large guanine nucleotide-binding protein 3 [Brassica napus] emb|CDY29924.1| BnaC05g29120D [Brassica napus] Length = 840 Score = 57.0 bits (136), Expect(2) = 9e-10 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QLVVNGCPL+PEEMAE LNC LP Sbjct: 251 ANQLRPEQLVVNGCPLKPEEMAELLNCPLP 280 Score = 33.5 bits (75), Expect(2) = 9e-10 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPP+KLKPG Y + KE Sbjct: 274 LLNCPLPPEKLKPGSYWYDKE 294 >emb|CDY12271.1| BnaA09g24710D [Brassica napus] Length = 842 Score = 54.3 bits (129), Expect(2) = 1e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGCPL+PEEM E LNC LP Sbjct: 249 ANQLRPEQLIVNGCPLKPEEMDELLNCPLP 278 Score = 35.8 bits (81), Expect(2) = 1e-09 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPP+KLKPGRY + KE Sbjct: 272 LLNCPLPPEKLKPGRYWYDKE 292 >ref|XP_013586984.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Brassica oleracea var. oleracea] ref|XP_013586985.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Brassica oleracea var. oleracea] emb|CDY22573.1| BnaC05g24110D [Brassica napus] Length = 841 Score = 54.3 bits (129), Expect(2) = 1e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGCPL+PEEM E LNC LP Sbjct: 254 ANQLRPEQLIVNGCPLKPEEMDELLNCPLP 283 Score = 35.8 bits (81), Expect(2) = 1e-09 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPP+KLKPGRY + KE Sbjct: 277 LLNCPLPPEKLKPGRYWYDKE 297 >ref|XP_009114940.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Brassica rapa] ref|XP_009114941.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Brassica rapa] ref|XP_013731433.1| extra-large guanine nucleotide-binding protein 3-like [Brassica napus] Length = 836 Score = 54.3 bits (129), Expect(2) = 1e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGCPL+PEEM E LNC LP Sbjct: 249 ANQLRPEQLIVNGCPLKPEEMDELLNCPLP 278 Score = 35.8 bits (81), Expect(2) = 1e-09 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPP+KLKPGRY + KE Sbjct: 272 LLNCPLPPEKLKPGRYWYDKE 292 >ref|XP_013586986.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X2 [Brassica oleracea var. oleracea] Length = 831 Score = 54.3 bits (129), Expect(2) = 1e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGCPL+PEEM E LNC LP Sbjct: 254 ANQLRPEQLIVNGCPLKPEEMDELLNCPLP 283 Score = 35.8 bits (81), Expect(2) = 1e-09 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPP+KLKPGRY + KE Sbjct: 277 LLNCPLPPEKLKPGRYWYDKE 297 >ref|XP_010478615.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Camelina sativa] ref|XP_010478616.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Camelina sativa] Length = 858 Score = 52.4 bits (124), Expect(2) = 2e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNG PL+PEEMAE LNC LP Sbjct: 265 ANQLRPEQLIVNGYPLKPEEMAELLNCPLP 294 Score = 37.0 bits (84), Expect(2) = 2e-09 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPPQKLKPGRY + KE Sbjct: 288 LLNCPLPPQKLKPGRYWYDKE 308 >ref|XP_020693721.1| extra-large guanine nucleotide-binding protein 3 [Dendrobium catenatum] gb|PKU62292.1| Guanine nucleotide-binding protein alpha-1 subunit [Dendrobium catenatum] Length = 866 Score = 54.7 bits (130), Expect(2) = 3e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGCPLRPEEMA+ L C LP Sbjct: 279 ANQLRPEQLIVNGCPLRPEEMADLLGCHLP 308 Score = 33.9 bits (76), Expect(2) = 3e-09 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + C LPP+KLKPGRY + KE Sbjct: 302 LLGCHLPPEKLKPGRYWYDKE 322 >ref|XP_020868438.1| extra-large guanine nucleotide-binding protein 3 [Arabidopsis lyrata subsp. lyrata] gb|EFH67216.1| extra-large GTP-binding protein 3 [Arabidopsis lyrata subsp. lyrata] Length = 847 Score = 52.0 bits (123), Expect(2) = 3e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNG PL+PEEMAE LNC LP Sbjct: 258 ANQLRPEQLIVNGYPLKPEEMAELLNCLLP 287 Score = 36.6 bits (83), Expect(2) = 3e-09 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPPQKLKPGRY + KE Sbjct: 281 LLNCLLPPQKLKPGRYWYDKE 301 >ref|XP_010499742.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Camelina sativa] ref|XP_019099335.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Camelina sativa] Length = 852 Score = 52.4 bits (124), Expect(2) = 4e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNG PL+PEEMAE LNC LP Sbjct: 259 ANQLRPEQLIVNGYPLKPEEMAELLNCPLP 288 Score = 35.8 bits (81), Expect(2) = 4e-09 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPPQKLKPG+Y + KE Sbjct: 282 LLNCPLPPQKLKPGKYWYDKE 302 >gb|OAP18477.1| XLG3 [Arabidopsis thaliana] Length = 848 Score = 50.8 bits (120), Expect(2) = 8e-09 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNG PL+PEEMA+ LNC LP Sbjct: 259 ANQLRPEQLIVNGYPLKPEEMADLLNCLLP 288 Score = 36.6 bits (83), Expect(2) = 8e-09 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPPQKLKPGRY + KE Sbjct: 282 LLNCLLPPQKLKPGRYWYDKE 302 >ref|NP_174475.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] ref|NP_849737.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] ref|NP_001185125.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] ref|NP_001319126.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] ref|NP_001320661.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] ref|NP_001320662.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] sp|Q9C516.1|XLG3_ARATH RecName: Full=Extra-large guanine nucleotide-binding protein 3; AltName: Full=Extra-large GTP-binding protein 3; Short=Extra-large G-protein 3 gb|AAG50710.1|AC079041_3 G-protein, putative [Arabidopsis thaliana] gb|AAG50792.1|AC074309_9 G-protein alpha subunit, putative [Arabidopsis thaliana] dbj|BAF01414.1| hypothetical protein [Arabidopsis thaliana] dbj|BAH19924.1| AT1G31930 [Arabidopsis thaliana] dbj|BAH20323.1| AT1G31930 [Arabidopsis thaliana] gb|ACT10805.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|AEE31417.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|AEE31418.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|AEE31419.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|ANM58207.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|ANM58208.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gb|ANM58209.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] Length = 848 Score = 50.8 bits (120), Expect(2) = 8e-09 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNG PL+PEEMA+ LNC LP Sbjct: 259 ANQLRPEQLIVNGYPLKPEEMADLLNCLLP 288 Score = 36.6 bits (83), Expect(2) = 8e-09 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPPQKLKPGRY + KE Sbjct: 282 LLNCLLPPQKLKPGRYWYDKE 302 >ref|XP_013749173.1| extra-large guanine nucleotide-binding protein 3-like [Brassica napus] ref|XP_013749175.1| extra-large guanine nucleotide-binding protein 3-like [Brassica napus] Length = 837 Score = 53.5 bits (127), Expect(2) = 1e-08 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGC L+PEEMAE LNC LP Sbjct: 248 ANQLRPEQLIVNGCALKPEEMAELLNCPLP 277 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPP+KLKPG Y + KE Sbjct: 271 LLNCPLPPEKLKPGGYWYDKE 291 >ref|XP_009145218.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Brassica rapa] ref|XP_018514775.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Brassica rapa] Length = 837 Score = 53.5 bits (127), Expect(2) = 1e-08 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 141 ANQLPPKQLVVNGCPLRPEEMAEFLNCQLP 52 ANQL P+QL+VNGC L+PEEMAE LNC LP Sbjct: 248 ANQLRPEQLIVNGCALKPEEMAELLNCPLP 277 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 65 IANCQLPPQKLKPGRY*HHKE 3 + NC LPP+KLKPG Y + KE Sbjct: 271 LLNCPLPPEKLKPGGYWYDKE 291