BLASTX nr result
ID: Ophiopogon26_contig00019186
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00019186 (637 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261505.1| probable E3 ubiquitin-protein ligase ARI8 [A... 60 6e-07 >ref|XP_020261505.1| probable E3 ubiquitin-protein ligase ARI8 [Asparagus officinalis] gb|ONK72465.1| uncharacterized protein A4U43_C04F19720 [Asparagus officinalis] Length = 584 Score = 60.1 bits (144), Expect = 6e-07 Identities = 33/65 (50%), Positives = 37/65 (56%), Gaps = 24/65 (36%) Frame = +2 Query: 2 GYYLPEHEDRKRQLFEYLQ------------------------ENPSGDSQEFISFRSKL 109 GYYLP+ ED KRQLFEYLQ ENPSGDSQEF++FR+KL Sbjct: 430 GYYLPDTEDAKRQLFEYLQGEAESGLERLHACAEKELQSYFDAENPSGDSQEFVAFRTKL 489 Query: 110 AGLTR 124 LTR Sbjct: 490 VDLTR 494